KEGG   Burkholderia stabilis: BBJ41_27610Help
Entry
BBJ41_27610       CDS       T04946                                 

Definition
(GenBank) 3-deoxy-7-phosphoheptulonate synthase
  KO
K01626  3-deoxy-7-phosphoheptulonate synthase [EC:2.5.1.54]
Organism
bstl  Burkholderia stabilis
Pathway
bstl00400  Phenylalanine, tyrosine and tryptophan biosynthesis
bstl01100  Metabolic pathways
bstl01110  Biosynthesis of secondary metabolites
bstl01130  Biosynthesis of antibiotics
bstl01230  Biosynthesis of amino acids
bstl02024  Quorum sensing
Module
bstl_M00022  Shikimate pathway, phosphoenolpyruvate + erythrose-4P => chorismate
Brite
KEGG Orthology (KO) [BR:bstl00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    BBJ41_27610
 09140 Cellular Processes
  09145 Cellular community - prokaryotes
   02024 Quorum sensing
    BBJ41_27610
Enzymes [BR:bstl01000]
 2. Transferases
  2.5  Transferring alkyl or aryl groups, other than methyl groups
   2.5.1  Transferring alkyl or aryl groups, other than methyl groups (only sub-subclass identified to date)
    2.5.1.54  3-deoxy-7-phosphoheptulonate synthase
     BBJ41_27610
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: DAHP_synth_1
Motif
Other DBs
NCBI-ProteinID: AOR71245
UniProt: A0A1D7ZN01
LinkDB All DBs
Position
2:complement(2190364..2191494)
Genome map
AA seq 376 aa AA seqDB search
MQNLDNPSHDREVGSADATQDTTRIDDVRIGAVRPLISPALLLDELPVPAATQTLVEDTR
RAIGDILHGRDDRLLLVVGPCSIHDHDQALDYARRLKVAADALKDDLLITMRVYFEKPRT
TVGWKGYINDPRLDGSFRINEGLRAARQLLLDINALGLPASTEFLDLLSPQYIADLIAWG
AIGARTTESQSHRQLASGLSCPIGFKNGTDGGVQVASDAIVAAAASHAFMGMTKMGMAAI
FETRGNDDAHVILRGGKNGPNYDAAHVEECCAVLRKAGLREQVMVDCSHANSNKSHERQI
EVAQDLARQLSQGEHRIVGVMVESHLEAGRQDLKPGVPLKYGVSITDACLSWTQTEPVLD
VLAEAVRHRRVYSRNA
NT seq 1131 nt NT seq  +upstreamnt  +downstreamnt
atgcagaacctcgacaatccttcccacgatcgcgaggtaggcagcgccgacgcgacgcag
gacaccacgcgtatcgacgacgtccgcatcggcgccgtgcgtccgctgatttcgcccgcg
ctgctgctggacgagctgccggtgccggccgccacgcagacgctcgtcgaggatacgcgc
cgcgcgatcggcgacatcctgcacggccgcgacgaccggctgctgctcgtcgtcggcccg
tgctcgatccacgatcacgaccaggcgctcgactacgcgcgccgcttgaaggtcgcggcc
gatgcgctgaaggacgacctgctgatcacgatgcgcgtctacttcgagaagccgcgcacg
acggtcggctggaaggggtacatcaacgatccgcgcctcgacggcagcttccgcatcaac
gaagggctgcgcgccgcgcggcagttgctgctcgacatcaacgcgctcggcctgccggcc
tcgaccgaattcctcgacctgctgagcccgcaatacatcgccgacctgatcgcgtggggc
gcgatcggcgcgcgtacgaccgagagccagagccatcgccagctcgcatcgggcctgagc
tgcccgatcggcttcaagaacggcaccgacggcggcgtgcaggtcgcgtcggacgcgatc
gtcgccgcggccgcgagccatgcgttcatggggatgacgaagatggggatggccgcgatc
ttcgagacgcgcggcaacgacgacgcgcacgtgatcctgcgcggcggcaagaacggtccg
aactacgacgccgcgcatgtcgaggaatgctgcgcggtgctgcgcaaggccgggttgcgc
gagcaggtgatggtcgactgctcgcacgcgaactcgaacaagtcgcacgagcggcagatc
gaggtggcgcaggatctcgcgcggcaactgtcgcaaggcgagcaccggatcgtcggcgtg
atggtcgagagccatctcgaggccgggcgccaggacctgaagccgggcgtgccgctgaag
tacggcgtgtcgatcaccgacgcgtgcctgagctggacgcagaccgagccggtgctcgac
gtgctggccgaggcggtgcggcatcggcgcgtgtattcgcgcaatgcgtga

DBGET integrated database retrieval system