KEGG   Burkholderia stabilis: BBJ41_28165Help
Entry
BBJ41_28165       CDS       T04946                                 

Definition
(GenBank) 2,4-dihydroxyacetophenone dioxygenase
Organism
bstl  Burkholderia stabilis
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Cupin_2 Cupin_7 AraC_binding
Motif
Other DBs
NCBI-ProteinID: AOR71351
UniProt: A0A1D7ZN96
LinkDB All DBs
Position
2:complement(2307764..2308297)
Genome map
AA seq 177 aa AA seqDB search
MVDKAVSEFWQNIPPIANPFKPDALPEAYIPNAATDDERYYVPFTETVSSRPLWISPSQN
KWCDILMAKEAGLVNRHYHPHEVFAYTLSGKWGYLEHEWTATRGDFVYETPGEGHTLVAF
DHPEPMRAFFIVKGPLIWLDEAGNPDGYFDVHSYIAMCKAHYEKVGLGAQAIEKLFR
NT seq 534 nt NT seq  +upstreamnt  +downstreamnt
gtggtcgacaaagccgtatccgaattctggcaaaacatcccgccgattgccaatccgttc
aagcccgatgcgctgcccgaagcctacatcccgaacgcggccaccgacgacgagcgttat
tacgttccgttcaccgaaacggtttcgtcgcggccgctgtggatctcgccgtcgcagaac
aaatggtgcgacatcctgatggcgaaggaagccgggctcgtgaaccggcactatcacccg
cacgaggtgttcgcgtacacgctgtcgggcaaatgggggtatctggagcacgaatggacc
gcgacgcgcggcgatttcgtgtacgagacgccgggcgaaggccacacgctcgtcgcgttc
gaccaccccgagccgatgcgcgcgttcttcatcgtcaaggggccgctgatctggctcgac
gaggcaggcaaccccgacggctacttcgacgtgcattcgtacatcgcgatgtgcaaggcg
cattacgagaaggtcggcctcggcgcgcaagcgatcgagaagctgttccgctga

DBGET integrated database retrieval system