KEGG   Burkholderia stabilis: BBJ41_28170Help
Entry
BBJ41_28170       CDS       T04946                                 

Definition
(GenBank) AraC family transcriptional regulator
Organism
bstl  Burkholderia stabilis
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: AraC_binding_2 HTH_18 HTH_AraC
Motif
Other DBs
NCBI-ProteinID: AOR71352
UniProt: A0A1D7ZNB6
LinkDB All DBs
Position
2:2308475..2309455
Genome map
AA seq 326 aa AA seqDB search
MTNSTVFSRTRGSTADVPARDRMAYWDAFNAATLVGLRCSSLSPAGLEVEKTDIALPGLG
IADISGRDHVIERSPALVRQLPKESLFACQILSGRAYFIQRDRCLLAEAGDVVVYDTRVP
YLFGFLTPMRQLLIDIPITTFDDRLDAELAALPLRIAPKPGAGAMLGTTLRASVERFMKE
PVEQDAARFAEHTRTLIAELIDAEVNGAGASRASLSYLLTAKQYIATHLGEPELGPQAVA
DAVGLSLRHLGRLFAAEGESITQHIWSERLSHAHRELTDARLRKTSIGEIAFRWGFSSQA
HFSRAIRERYGASPMALRDAVRAAER
NT seq 981 nt NT seq  +upstreamnt  +downstreamnt
gtgacgaattcgaccgttttttcacgcacgcgaggctcgacggccgacgtgccggcgcgc
gacaggatggcgtattgggatgcgttcaatgcggcgacgctggtcggtttgcgctgctcg
tcgctgtcgcccgcggggctcgaagtggagaagaccgacatcgcgctgccgggcctcggc
atcgccgatatcagcggccgggatcacgtgatcgagcgcagccccgcgctggtgcgccag
ttgccgaaggagtcgctgttcgcgtgccagatcctgagcgggcgcgcgtatttcatccag
cgtgaccggtgcctgctcgcggaagccggcgacgtggtcgtctacgacacgcgcgtgcct
tatctgttcggattcctgacgccgatgcggcaattgctgatcgatatcccgatcacgacg
ttcgacgaccggctcgatgccgaactggcggcgctgccgctgcggatcgcaccgaagccg
ggcgccggcgcgatgctcggcacgacgctgcgtgcgagcgtcgagcggttcatgaaagag
ccggtcgagcaggacgccgcgcgttttgccgagcacacgcgcacgctgatcgcggaactc
atcgacgcggaagtgaacggcgcgggcgcgtcgcgcgcatcgctgtcgtacctgctgacc
gcgaagcagtacatcgcgacgcatctcggcgagccggagctcgggccgcaggccgtcgcc
gatgcggtcggcctgtcgttgcggcacctcggccggctctttgccgccgaaggcgagtcg
atcacgcagcacatctggtcggagcggctgtcgcacgcgcatcgcgagctgacggacgcg
cggctgcgcaagacgagcatcggcgagattgcgtttcgctgggggttctcgagccaggcg
cacttcagccgcgcgattcgcgagcgctatggcgcgtcgccgatggcgttgcgcgacgcg
gtgcgtgcggcggaacgctga

DBGET integrated database retrieval system