KEGG   Burkholderia stabilis: BBJ41_30825Help
Entry
BBJ41_30825       CDS       T04946                                 

Definition
(GenBank) 4-hydroxyphenylacetate 3-monooxygenase, reductase component
  KO
K00484  flavin reductase (NADH) [EC:1.5.1.36]
Organism
bstl  Burkholderia stabilis
Pathway
bstl00350  Tyrosine metabolism
bstl00740  Riboflavin metabolism
bstl01100  Metabolic pathways
bstl01120  Microbial metabolism in diverse environments
bstl01220  Degradation of aromatic compounds
Brite
KEGG Orthology (KO) [BR:bstl00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00350 Tyrosine metabolism
    BBJ41_30825
  09108 Metabolism of cofactors and vitamins
   00740 Riboflavin metabolism
    BBJ41_30825
Enzymes [BR:bstl01000]
 1. Oxidoreductases
  1.5  Acting on the CH-NH group of donors
   1.5.1  With NAD+ or NADP+ as acceptor
    1.5.1.36  flavin reductase (NADH)
     BBJ41_30825
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Flavin_Reduct
Motif
Other DBs
NCBI-ProteinID: AOR71827
UniProt: A0A1D7ZPP3
LinkDB All DBs
Position
2:complement(2903299..2903853)
Genome map
AA seq 184 aa AA seqDB search
MSPTSSTTAIPRPARVEPTDAQKAFRQAMAHLGAAVNVITTAGPHGRCGITASAVCSVTD
APPTLLVCLNRSSAMHATFERNRHVCINVLPAEHELLARHFAGLTDLPMERRFDLPVWDR
GEQDVPVLRDALASLQGTIAEMKEVGSHSVMFIEATSIRVRDDGDSLIYFSRAFHRVSRT
ACVR
NT seq 555 nt NT seq  +upstreamnt  +downstreamnt
atgtcccccacgtcctccacgaccgctatcccgcgaccggcgcgcgtcgagccgaccgac
gcgcagaaggctttccggcaagcgatggcccacctcggcgcggccgtcaacgtgatcacc
accgccgggccgcacggccgctgcgggatcaccgcgagcgccgtctgttccgtcaccgac
gcgccgccgacgctgctcgtgtgcctgaaccggtcgagcgcgatgcacgcgaccttcgag
cgcaaccgccatgtctgcatcaacgtgctgccggccgagcacgaactgctcgcgcggcat
ttcgcggggctcactgatctgccgatggaacggcgtttcgacctgcccgtttgggatcgc
ggcgaacaggacgtgcccgtgctgcgcgacgcgctcgcgagcctgcagggcacgatcgcc
gagatgaaggaagtcggctcgcattcggtgatgttcatcgaggcgacgtcgatccgcgtg
cgcgacgacggcgacagcctcatctacttcagccgcgcgtttcatcgcgtctcgcgcacg
gcgtgcgtgcgctga

DBGET integrated database retrieval system