KEGG   Burkholderia stabilis: BBJ41_33690Help
Entry
BBJ41_33690       CDS       T04946                                 

Definition
(GenBank) class C beta-lactamase
  KO
K01467  beta-lactamase class C [EC:3.5.2.6]
Organism
bstl  Burkholderia stabilis
Pathway
bstl01501  beta-Lactam resistance
bstl02020  Two-component system
Brite
KEGG Orthology (KO) [BR:bstl00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   02020 Two-component system
    BBJ41_33690
 09160 Human Diseases
  09175 Drug resistance: antimicrobial
   01501 beta-Lactam resistance
    BBJ41_33690
Enzymes [BR:bstl01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.2  In cyclic amides
    3.5.2.6  beta-lactamase
     BBJ41_33690
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Beta-lactamase
Motif
Other DBs
NCBI-ProteinID: AOR72581
UniProt: A0A1D7ZRV4
LinkDB All DBs
Position
3:complement(233795..234964)
Genome map
AA seq 389 aa AA seqDB search
MRFNATRFAATLFVAACATATAGRAAAFTQDDLHATVTRHVAPLMKQYAIPGMAIGVVAD
GKPYVFDYGVMSTQTGKPVTGDTLFEIGSVSKTLTATLASDAQEGGELSLTDPAGKYLPA
LQGKPFGVVTLLQLGTHTPGGMPLQVPDGIRDEAGLMRYLDAWRPAYAPGTRRTYSNVAI
GMLGRLTAKAMHKDFAALMEQRLFPALGMMHTYINVPDARTADYAQGYTQDGKPIRMTGG
MLWQEAYGVRTTAADLLRFVQANMGLVETAPRLQRAIERTHTGYFRAGPLTQDLIWEQYP
YPVALPTLLEGNAPKMLFNATPASAIKPPLAPNSNTWINKTGSTNGFSTYVAFVPAKRIA
IVMLANRSFPIEDRVKVAYQILGSLGDGR
NT seq 1170 nt NT seq  +upstreamnt  +downstreamnt
atgcgattcaacgcgacacgcttcgccgcgaccctgttcgtcgccgcgtgcgccaccgcc
acggccggccgcgcggccgcattcacgcaggacgacctccacgccaccgtgacccgccac
gtcgcgccgctgatgaagcagtacgcgattcccggcatggcgatcggcgtcgtcgccgac
ggcaagccctacgtgttcgactacggcgtgatgtcgacgcaaaccggcaagcccgtcacc
ggcgacacgctgttcgaaatcggctccgtcagcaagacgctgaccgcgacgctcgcatcc
gatgcgcaggagggcggcgagctgtcgctcacggacccggcgggcaaatacctgcccgcg
ctgcagggcaagccgttcggcgtcgtgacgctgctccagctcggcacgcatacgcccggc
ggcatgccgctgcaggtgccggacggcatccgcgacgaagccggcctgatgcgctatctc
gacgcgtggcggcccgcgtatgcgccgggcacgcgccgcacgtattcgaacgtcgcgatc
gggatgctcggcaggctcaccgcgaaggcgatgcacaaggatttcgcggcgctgatggag
cagcggctgttccccgcgctcgggatgatgcatacgtacatcaacgtgcccgacgcgcgc
acggccgactatgcgcagggctatacgcaggacggcaagccgatccggatgacgggcggc
atgctgtggcaggaggcgtacggcgtgcggaccacggcggccgacctgctgcgtttcgtg
caggcgaacatggggctggtcgaaacggcgccgcggctgcagcgcgcgatcgaacgcacg
cacaccggctatttccgcgcggggccgctgacgcaggacctgatctgggaacagtatccg
tacccggttgcgctgccgacgctgctcgaaggcaacgcgccgaagatgttgttcaacgcg
acgcccgccagtgcgatcaagccgccgctcgcaccgaacagcaacacctggatcaacaag
acgggctcgaccaacggtttcagcacgtatgtcgcattcgtccccgcgaaacggatcgcg
atcgtgatgctcgcgaaccgcagcttcccgatcgaggatcgcgtgaaggtcgcttaccag
atcctcgggtcgctcggcgacgggcggtaa

DBGET integrated database retrieval system