KEGG   Burkholderia stabilis: BBJ41_35540
Entry
BBJ41_35540       CDS       T04946                                 

Definition
(GenBank) fructose-bisphosphate aldolase
  KO
K18287  2-amino-4,5-dihydroxy-6-oxo-7-(phosphooxy)heptanoate synthase [EC:4.1.2.56]
Organism
bstl  Burkholderia stabilis
Pathway
bstl00997  Biosynthesis of various secondary metabolites - part 3
bstl01100  Metabolic pathways
bstl01110  Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:bstl00001]
 09100 Metabolism
  09110 Biosynthesis of other secondary metabolites
   00997 Biosynthesis of various secondary metabolites - part 3
    BBJ41_35540
Enzymes [BR:bstl01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.2  Aldehyde-lyases
    4.1.2.56  2-amino-4,5-dihydroxy-6-oxo-7-(phosphooxy)heptanoate synthase
     BBJ41_35540
SSDB
Motif
Pfam: DeoC
Other DBs
NCBI-ProteinID: AOR72903
UniProt: A0A1D7ZSN3
LinkDB
Position
3:679186..679986
AA seq 266 aa
MDSLLSVSGKALRMRRVVRAASGKCLMVPLDHSLADGPIAHPQQLRQLVGDIAAHGGDAI
VVHRGRARFLSPDVLNDLALVVHLNGCTRYAEDANAKTLFASVEDALSSGADAVSVHVNL
GSKTESQQLLDLSRIATECARWSLPLLAMIYPRGPGLGDRPQAELIAHAANVAADLGADI
VKLPYSGDAASMADIIAGSSLPVLVAGGAKLPEDEFVAFTARVMNAGALGIAAGRNVFAA
PKAAPLIRRLSDAVHGVGRRAAHLAA
NT seq 801 nt   +upstreamnt  +downstreamnt
atggactctcttctatcggtttctggcaaggcgctgaggatgcggcgggtcgtgcgcgcc
gcatcgggcaagtgtttgatggtgccgctcgaccattcgctcgcggacggtccgatcgcc
catccgcagcagttgcggcagctcgtcggcgacatcgccgcgcacggtggcgatgcgatc
gtcgtgcatcgcggccgtgcgcgtttcctgtctcccgacgtgctgaacgatctcgcgctc
gtcgtgcacctgaacggctgcacgcgctacgcggaggacgcgaacgcgaagacgctgttc
gcgagcgtcgaggacgcgttgtcgagcggcgcggacgcggtcagcgtgcacgtgaatctc
ggctccaagacggaatcccagcagttgctcgacctgagccgcatcgcgaccgagtgcgcg
cgctggtcgctgccgctgctcgcgatgatctatccgcgcggcccgggcctcggcgatcgt
ccgcaggccgaactgatcgcccatgcggcgaacgtcgcggcggatctcggcgccgacatc
gtcaagctgccctacagcggcgatgccgcgagcatggccgacatcatcgccggctcgtcg
ctgccggtgctggtcgccggcggcgcgaagctgccggaggacgagttcgtcgcgttcacc
gcgcgcgtgatgaacgcgggtgcgctcggcatcgcggccggccgcaacgtgttcgccgcg
ccgaaggccgcgccgctgatccgccgtctgtccgatgccgtacacggcgtcgggcggcgc
gccgcgcacctggccgcctga

DBGET integrated database retrieval system