KEGG   Burkholderia stabilis: BBJ41_37850Help
Entry
BBJ41_37850       CDS       T04946                                 

Definition
(GenBank) aldehyde dehydrogenase
Organism
bstl  Burkholderia stabilis
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Aldedh
Motif
Other DBs
NCBI-ProteinID: AOR73287
UniProt: A0A1D7ZTW1
LinkDB All DBs
Position
3:1216374..1217855
Genome map
AA seq 493 aa AA seqDB search
MAAMEIQMTKRTIDLKHPREFYIGGQWVQPSTADTFDVFDCATEEVVATVAKAASADMQR
AITAARDAFDNGPWPRMTPQERAVYLEKFAQRLEALNDDFARIWAIETGIVYKVAQPRIG
LFISGAFRQYAAMASTFPFVEEHRSVTGNLGYRVYEPVGVVGEIIPWNGPAGLMAYKTAP
ALLAGCTLVIKSSPEAPCSAYLFAEICEEIGLPPGVINVVTADRDVSEELVRDPRVDKIT
FTGSTGAGRRIASIAGDRVARVTLELGGKSPAVILDDYDIEAAANVLGPSYFGYNTGQIC
HSLTRVIVPRAKHDAMVEALSNAAKKIVLGDQFAPETTSGPLASARQRETVERFVAKGIA
EGATLAAGGKRPAGLERGFFFEPTVFGNVDNRSTIAQEEIFGPVLSVIPADDEASAIAMA
NDTPFGLNAAVFTNDSARALHVARQIRSGTVGHNGPRTDFSIGFGGFKQSGIGREGGVEG
LAAFMESKTIVMA
NT seq 1482 nt NT seq  +upstreamnt  +downstreamnt
atggcggccatggagattcagatgaccaagagaacgatcgacctcaagcatcctcgagag
ttctatatcggtgggcaatgggttcaaccgtccaccgccgacacgttcgacgtgttcgat
tgcgcgacggaagaagtcgtggcgaccgtggcaaaggccgcgtccgccgacatgcagcgt
gccatcacggcagcgcgtgacgccttcgacaacggcccgtggccccggatgacgccgcag
gagcgcgcggtttatctcgagaagttcgcgcaacggctggaagcgctgaacgacgatttc
gcgcgtatctgggcgatcgagaccggcatcgtctataaagtcgcgcagccccgtatcggg
ctgttcatcagcggcgcatttcgccagtacgcggcaatggcatcgacctttccgttcgtc
gaagagcatcggtcggtcaccggtaatctcggctatcgcgtctacgagccggtcggcgtc
gtcggcgaaatcattccgtggaacggccccgccggtctgatggcgtacaagaccgcaccg
gcgctgctcgcaggctgcacgctggtgatcaaatcgtcgcccgaagcgccctgctcggcc
tacctgttcgccgagatctgcgaagaaatcggcttgccgcccggcgtgatcaacgtcgtg
acggccgatcgcgacgtatccgaggagttggttcgcgaccctcgcgtcgacaagatcacg
ttcacgggatcgaccggtgccggccgccggatcgcgtccatcgccggcgatcgcgtcgcg
cgcgtcacgctcgagctgggcggaaaatcgcccgccgtcattctcgacgactacgacatc
gaagccgcggccaacgtgctcggcccgtcctatttcggctacaacaccgggcagatctgc
cacagcctgacgcgcgtgatcgttccccgtgcgaagcacgatgcgatggtcgaagcgttg
tcgaacgccgcgaaaaagatcgtgctcggcgatcagttcgcgccggaaaccacctccggc
ccgctcgctagcgcacggcagcgggaaaccgtcgagcggttcgtcgccaagggcatcgcg
gaaggcgcaacgttggcagccggcggcaaacggccggccgggctggagcgcggcttcttc
ttcgagccgacggtgttcggcaacgtggacaatcgttcgacgatcgcgcaggaagaaatc
ttcggcccggtgctgagcgtcattcccgccgacgacgaagcgagcgcgatcgcgatggcg
aacgacacgccgttcggcctgaatgccgcggtcttcacgaacgacagcgcccgtgcgctg
cacgtggcacggcagatccgctcgggtacggtcggccacaatggcccgcgcaccgatttc
tcgatcggcttcggcgggttcaagcagtcgggcatcgggcgtgaaggcggtgtcgaaggg
ctggccgcgttcatggaatcgaaaaccatcgtgatggcttga

DBGET integrated database retrieval system