KEGG   Bacteriovorax stolpii: C0V70_00355Help
Entry
C0V70_00355       CDS       T05263                                 

Definition
(GenBank) hypothetical protein
  KO
K03587  cell division protein FtsI (penicillin-binding protein 3) [EC:3.4.16.4]
Organism
bsto  Bacteriovorax stolpii
Pathway
bsto00550  Peptidoglycan biosynthesis
bsto01501  beta-Lactam resistance
Brite
KEGG Orthology (KO) [BR:bsto00001]
 09100 Metabolism
  09107 Glycan biosynthesis and metabolism
   00550 Peptidoglycan biosynthesis
    C0V70_00355
 09160 Human Diseases
  09175 Drug resistance: antimicrobial
   01501 beta-Lactam resistance
    C0V70_00355
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01011 Peptidoglycan biosynthesis and degradation proteins [BR:bsto01011]
    C0V70_00355
  09182 Protein families: genetic information processing
   03036 Chromosome and associated proteins [BR:bsto03036]
    C0V70_00355
Enzymes [BR:bsto01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.16  Serine-type carboxypeptidases
    3.4.16.4  serine-type D-Ala-D-Ala carboxypeptidase
     C0V70_00355
Peptidoglycan biosynthesis and degradation proteins [BR:bsto01011]
 Peptidoglycan biosynthesis and degradation
  DD-Transpeptidase (Class B PBP)
   C0V70_00355
Chromosome and associated proteins [BR:bsto03036]
 Prokaryotic Type
  Chromosome partitioning proteins
   Divisome proteins
    C0V70_00355
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Transpeptidase PBP_dimer PASTA
Motif
Other DBs
NCBI-ProteinID: AUN96579
UniProt: A0A2K9NM47
LinkDB All DBs
Position
73479..75452
Genome map
AA seq 657 aa AA seqDB search
MNRVEKNRIIFVFTCFCLFFLLVLGKAFKVQLVDAGDLIVRANSQFLRQATVYPKRGNIY
DRSGHPLALNVQTYSIFTIPKSTDGKNDVYKKLAKIVPELSYKEMITTIKKRKRFTWLGR
KLRLSKDQVEDIKELKGIFIEGTPERTYPNHELLSQVIGFVGLDNSGLSGLEYMYNKELR
GNPVTLKYTIDNKGRAIKFESHQDVTAQAKDIYLTIDKDIQGMAEKYLKEAVLKHNADKG
GIGVIDASTGEILAIANYPTFDPNNVKGSAPESRKLSFAIDPFEPGSTFKIFTAASALEH
KTATINSTYYAEQGRMRVDNHWIKEAESHEKFEWISVADIIRYSSNVGTTKLAFDLTFPK
LKETLKELNFGNKTGIEVPGESRGIFTEADNVTPLSLSNISFGQGIAVTGVQMMAAYAAI
ANGGEYIKPTLIKRDPNQVSVSELEPENANQLEKRRRVLSQKNTEDLTKALVLAVEKGTG
GNAKIPHFQIAGKTATAQRVDKNGGYKGYVSGFIGYPVNVDRKFVIAVYIDNPKTGGYYG
GAVAGPVFKNLAEYMLYKNKDISRLAEHEDNDYDLKKVKTNIDMVQVKEAASRSLTPGIV
PNMMGLDKITTTNISLKLNLQVVHKGMGVVSSQYPPAGTPIGDDTVVKLEYSPPTYE
NT seq 1974 nt NT seq  +upstreamnt  +downstreamnt
atgaatagagttgaaaaaaataggatcatctttgtttttacctgtttctgtttgtttttc
cttctcgttttagggaaagcatttaaggttcagctagtcgatgctggagatctcattgtt
cgcgccaattcacaattcttaagacaggcaactgtttatccaaaacgtggaaacatctac
gaccgttcaggtcacccacttgctcttaacgttcaaacgtacagtattttcaccatccca
aaatcaactgatgggaaaaatgatgtttataaaaaactggccaagatcgttccggagctt
tcgtacaaagaaatgatcacgacgatcaaaaagagaaagagatttacctggcttggcaga
aagcttcgtctttcaaaagatcaggttgaagatatcaaggaactaaaaggtatcttcatt
gaaggaactccagagagaacttatccaaaccacgagcttctgtctcaggttatcgggttt
gttggtcttgataactcaggtctttcaggccttgagtacatgtacaacaaagagctaaga
ggaaatccggttactctaaaatatacgatcgacaacaagggccgcgcgattaagtttgaa
agtcatcaggatgtaacagctcaagcaaaagacatttacctgacgattgataaagacatc
cagggaatggccgaaaaatatttaaaggaagctgtcttaaaacacaatgcagataaaggt
gggattggtgttattgatgcttcgacaggtgaaatcctggcgattgctaactaccctact
tttgatccaaacaatgttaaaggatcagctcctgaatcaagaaagttaagttttgccatt
gatccgtttgagccaggttcaacatttaagatcttcacagcggcttcggcacttgagcac
aagacagcaactattaactctacttactatgctgaacaaggaagaatgagagttgataat
cactggattaaagaagctgaaagccatgaaaaatttgaatggatttcagttgcagatatt
attcgttactcttcaaacgtcgggacgacaaaacttgcatttgatctgactttcccaaaa
ttaaaagaaacattaaaagaactgaactttggaaataaaactggaattgaagtgccggga
gaatctcgcggtatttttactgaagcagacaacgtcacacctctttctttaagtaacatc
agtttcggtcaaggtattgctgttacaggtgttcagatgatggcagcctatgcggcgatt
gctaacggtggtgagtacattaagccaacacttattaagcgcgatccaaaccaggtgagc
gtttcagaattagaacctgaaaatgcgaatcaactagagaaaagaagaagagtcctgtcg
caaaagaatacagaggatctgacaaaggccctagtgttagcagttgaaaaaggaacggga
ggaaatgctaagatccctcacttccagattgcgggtaaaacagcgactgctcagcgtgta
gataaaaatggtggatataagggttatgtttctgggttcatcggatatccagttaacgta
gatagaaaatttgttatcgctgtttatattgataacccaaaaactggcggatattacggt
ggggcagttgcgggtccagtgtttaaaaaccttgcggagtatatgctttataaaaataaa
gacattagtagactcgcagaacatgaagacaatgattacgatctgaaaaaagttaagacc
aatatcgacatggttcaggttaaagaagcggcttcaagaagcttgactcctgggattgtg
ccgaacatgatggggctggataagattacaacgaccaacatctcgttgaagttaaacctt
caagttgttcataaaggaatgggagtggtttcatcacaatacccaccagcaggaacaccg
attggcgatgatactgttgtgaaattagaatattcacctccaacatacgaatag

DBGET integrated database retrieval system