KEGG   Bacteriovorax stolpii: C0V70_03330Help
Entry
C0V70_03330       CDS       T05263                                 

Definition
(GenBank) isocitrate dehydrogenase (NADP(+))
  KO
K00031  isocitrate dehydrogenase [EC:1.1.1.42]
Organism
bsto  Bacteriovorax stolpii
Pathway
bsto00020  Citrate cycle (TCA cycle)
bsto00480  Glutathione metabolism
bsto01100  Metabolic pathways
bsto01110  Biosynthesis of secondary metabolites
bsto01120  Microbial metabolism in diverse environments
bsto01130  Biosynthesis of antibiotics
bsto01200  Carbon metabolism
bsto01210  2-Oxocarboxylic acid metabolism
bsto01230  Biosynthesis of amino acids
Module
bsto_M00010  Citrate cycle, first carbon oxidation, oxaloacetate => 2-oxoglutarate
Brite
KEGG Orthology (KO) [BR:bsto00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    C0V70_03330
  09106 Metabolism of other amino acids
   00480 Glutathione metabolism
    C0V70_03330
Enzymes [BR:bsto01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.42  isocitrate dehydrogenase (NADP+)
     C0V70_03330
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Iso_dh
Motif
Other DBs
NCBI-ProteinID: AUN97155
UniProt: A0A2K9NQ23
LinkDB All DBs
Position
complement(707925..709151)
Genome map
AA seq 408 aa AA seqDB search
MTKIKVANPVVELDGDEMTRIIWKFIKEKLILPYLDVDIKYYDLGMEHRDATNDQVTVDA
AEAIKKYNVGIKCATITPDEARVKEFNLKEMWKSPNGTIRNILDGTVFREPIICKNVPRL
VPNWTAPIMIGRHAFGDQYRATDFVVPGKGKLTISFVGENGEKIEKEVYNFKGPGVALSM
YNTDESIRGFAHSCFNMALSKKWPLYFSSKNTILKKYDGRFKDIFEEIYQADYKKKFESL
GIVYEHRLIDDMVASALKWNGNFVWACKNYDGDVQSDTVAQGFGSLGLMTSVLVTPDGKT
MEAEAAHGTVTRHYRMHQQGKPTSTNPIASIFAWTRGLNHRGKLDNNPALVHFCETLEKV
CVETVESGKMTKDLAVCIYGDKVTADQYLTTEKFLDALDENLKKALKM
NT seq 1227 nt NT seq  +upstreamnt  +downstreamnt
atgacaaagatcaaagtagctaaccctgtggtggagcttgatggcgatgaaatgaccaga
atcatctggaagttcattaaagaaaaactaattcttccgtaccttgatgtagatattaag
tactacgatcttggaatggagcacagagatgcaactaacgatcaagtgactgttgatgct
gctgaagcaatcaagaagtacaacgttggtatcaagtgcgcgacaatcactccagatgaa
gcacgtgtaaaagaattcaacctaaaagaaatgtggaaatcaccaaatggtacaatcaga
aacattcttgatgggactgtatttcgtgaaccaatcatttgtaaaaacgttcctcgtcta
gttccaaactggactgcaccaatcatgatcggtcgtcacgctttcggtgaccagtaccgc
gcaactgatttcgtcgttccaggaaaaggaaaactgacgatttctttcgttggagaaaac
ggcgaaaagatcgaaaaagaagtttataacttcaaaggtccaggtgttgctctttctatg
tacaacacagatgagtctatcagaggatttgctcactcatgtttcaacatggccctttca
aaaaaatggccattgtatttttcatcgaaaaatacaatcttaaaaaagtacgacggtcgc
ttcaaagacatcttcgaagagatctaccaagcagactacaagaagaaattcgagtctcta
ggaatcgtttacgaacacagactaatcgacgatatggttgcctctgctcttaagtggaat
ggtaacttcgtttgggcatgtaaaaactacgacggtgacgttcagtcagatacagttgct
caaggtttcggctctcttggacttatgacttcagttcttgtcactccagatggaaagaca
atggaagctgaagcagctcacggaactgtaactcgtcactacagaatgcaccaacaagga
aaacctacgtcaacgaacccaatcgcttctatctttgcttggactcgcggtcttaaccac
agaggtaagttagataacaaccctgctctagttcacttctgtgaaactctagagaaagtt
tgtgttgaaactgttgagtctggaaaaatgactaaagaccttgcggtttgtatctacggt
gacaaggtaacagctgatcagtatttaacaactgagaagttccttgatgctcttgatgaa
aacctaaaaaaagcacttaaaatgtaa

DBGET integrated database retrieval system