KEGG   Bacteriovorax stolpii: C0V70_06480Help
Entry
C0V70_06480       CDS       T05263                                 

Gene name
ahpF
Definition
(GenBank) alkyl hydroperoxide reductase subunit F
  KO
K03387  NADH-dependent peroxiredoxin subunit F [EC:1.8.1.-]
Organism
bsto  Bacteriovorax stolpii
Brite
KEGG Orthology (KO) [BR:bsto00001]
 09190 Not Included in Pathway or Brite
  09191 Unclassified: metabolism
   99980 Enzymes with EC numbers
    C0V70_06480 (ahpF)
Enzymes [BR:bsto01000]
 1. Oxidoreductases
  1.8  Acting on a sulfur group of donors
   1.8.1  With NAD+ or NADP+ as acceptor
    1.8.1.-  
     C0V70_06480 (ahpF)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Pyr_redox_2 Pyr_redox_3 GIDA Pyr_redox Thioredoxin_3 FAD_binding_2 HI0933_like FAD_oxidored DAO Thi4 Glutaredoxin Lycopene_cycl Thioredoxin_4 NAD_binding_8 FAD_binding_3 AlaDh_PNT_C K_oxygenase FMO-like DSBA
Motif
Other DBs
NCBI-ProteinID: AUN97763
UniProt: A0A2K9NQI1
LinkDB All DBs
Position
1289842..1291401
Genome map
AA seq 519 aa AA seqDB search
MLDNNIIEQLKSVFAKLEKNVDLVYSESDHADQKDLVNMLEQVAGTSTNITAKPAIGDHK
APFPQFHLEYAGKANGITFKGIPSGHEFTSLILAILNSDNKGKFPDEAISSRMKKLKGPV
EVRTYVSLTCENCPDVIQFLNQMAVIHGNFKHTMIDGQYTQEEIKTLGIQGVPSVVVNDK
MIYSGRLNTIDLLSALEKAFGVQEVTGEVISQDLGEYDVVVVGGGPAGASAAIYSVRKGL
KTAMLAERIGGQVQDTKGIENLIGVKYTEGPQLAAQLNQHIAEYPVKVLEHRRVQNVISE
GKYKIVHLEGGEVIKTKALIVATGAKWRELNIPGEKEYIGRGVAFCPHCDGPYYKGKKIA
VVGGGNSGVEAAIDLAGIVKEVVLFEFNDTLKADQVLVNKLKSLPNVSIVTEARTSQVLG
DGGKVIGLEYENRKTKEMMKVDLDGIFVQIGLLPNSGFVKDVVETTKFGEIVVDNKGRTN
VPGIYAAGDVTTVPYKQIIIAMGEGAKAALAAFEDQMLA
NT seq 1560 nt NT seq  +upstreamnt  +downstreamnt
atgttagacaacaatatcatcgagcaattaaaatcagttttcgccaaattagaaaaaaat
gtagacttagtttacagcgaaagtgaccacgccgatcaaaaagacctggtcaacatgcta
gagcaggttgcaggaacttcaactaacatcacggccaagccagcaataggtgatcacaaa
gcaccttttcctcagtttcatttagaatacgccgggaaagcaaacggtattacgtttaaa
ggtatcccgagcggacatgagttcacatcgctgatcttagcgatcctaaactcagacaat
aaagggaaattccctgatgaagcgatttcaagccgtatgaaaaaactaaaaggaccggtt
gaagtcagaacttatgtttcactgacatgtgaaaactgtccggatgttatccagttctta
aaccagatggccgtgattcacggaaactttaagcacacgatgattgacgggcaatacact
caagaagaaattaaaacactaggtatccaaggggtgccaagtgtagtggtcaacgataaa
atgatttattctggccgcttaaatacaatcgacctgctctctgcactggaaaaagctttt
ggtgttcaggaagtaacaggcgaagtgatcagccaggatttaggcgaatatgatgttgtc
gttgttggtggtggacctgctggtgcttctgccgcgatttactctgttcgtaaaggtcta
aaaactgcgatgctggcagaaagaatcggaggtcaggtccaggatacaaaagggatcgaa
aaccttattggtgtaaaatacacagaaggtccacagcttgcggcccaacttaaccagcac
attgcagagtacccagttaaagttttagaacacagacgcgttcaaaacgttatctctgaa
ggaaaatataaaatcgtccatctggaaggtggagaagtgatcaaaacaaaagcactgatt
gtcgcaactggtgccaagtggagagagctcaacattccaggggaaaaagaatatatcggc
cgcggagtcgctttctgtcctcactgtgatggcccatactacaaaggtaaaaagattgcc
gttgttggtggtggtaactcaggtgttgaggccgcaatcgatcttgctggtatcgtaaaa
gaagttgtcttgtttgagttcaatgatacgttaaaagcagaccaggttttagttaataaa
ctgaagtctctgccaaacgtttcaatcgtgactgaagcccgcacatctcaagtattaggg
gatggaggaaaggttatcggacttgagtatgaaaacagaaagacaaaagaaatgatgaaa
gttgatttggacggaatctttgttcagatcggtcttctgccaaactcaggatttgtaaaa
gatgttgttgaaacaactaagtttggtgagattgttgtagataataaaggtagaacaaat
gttccgggtatctatgccgctggagacgtcactaccgttccttataagcagatcattatt
gccatgggcgagggagcgaaagctgctctggccgcatttgaagatcaaatgttagcgtaa

DBGET integrated database retrieval system