KEGG   Bacteriovorax stolpii: C0V70_07845Help
Entry
C0V70_07845       CDS       T05263                                 

Definition
(GenBank) succinate dehydrogenase/fumarate reductase iron-sulfur subunit
  KO
K00240  succinate dehydrogenase / fumarate reductase, iron-sulfur subunit [EC:1.3.5.1 1.3.5.4]
Organism
bsto  Bacteriovorax stolpii
Pathway
bsto00020  Citrate cycle (TCA cycle)
bsto00190  Oxidative phosphorylation
bsto00650  Butanoate metabolism
bsto01100  Metabolic pathways
bsto01110  Biosynthesis of secondary metabolites
bsto01120  Microbial metabolism in diverse environments
bsto01130  Biosynthesis of antibiotics
bsto01200  Carbon metabolism
Brite
KEGG Orthology (KO) [BR:bsto00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    C0V70_07845
   00650 Butanoate metabolism
    C0V70_07845
  09102 Energy metabolism
   00190 Oxidative phosphorylation
    C0V70_07845
Enzymes [BR:bsto01000]
 1. Oxidoreductases
  1.3  Acting on the CH-CH group of donors
   1.3.5  With a quinone or related compound as acceptor
    1.3.5.1  succinate dehydrogenase
     C0V70_07845
    1.3.5.4  fumarate reductase (quinol)
     C0V70_07845
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Fer2_3 Fer4_8 Fer4_7 Fer4_17 Fer2 Fer4_10 Fer4_9 Fer4_6 Fer4_4 Fer4_2 Fer4 Fer4_15 Fer4_22
Motif
Other DBs
NCBI-ProteinID: AUO00182
UniProt: A0A2K9NXE0
LinkDB All DBs
Position
complement(1575722..1576471)
Genome map
AA seq 249 aa AA seqDB search
MSLKLKIWRQKNSKDKGQMVDYNLDGVSPDMSFLEMLDILNNKLVREKGDQIAFDHDCRE
GICGMCSLMINGQAHGPQGGVTTCQLHMRKFKNGDEIVIEPWRAKAFPVVKDLMVDRSAF
DQIMAAGGYVNVNTGNAPDGNSILIGHEEAELAMDAAACIGCGACVASCKNASAMLFVAA
KVSQLALLPQGQVEAEHRALAMVEKMDELGFGNCTNEAECEAQCPKGIKLDNIARMNRGV
VQGIFAARK
NT seq 750 nt NT seq  +upstreamnt  +downstreamnt
atgtctctgaagttaaaaatctggagacaaaaaaatagcaaagataaaggacaaatggtc
gactataacctggatggcgtctctcctgatatgtcatttttggaaatgctagacatcctt
aacaacaaactggttcgcgaaaaaggtgaccagatcgcattcgaccacgactgccgcgaa
ggtatctgtggaatgtgttctcttatgatcaacggacaggcccacggaccacaaggtggc
gtaacaacttgtcagctacacatgagaaaattcaaaaatggtgatgaaatcgttatcgaa
ccatggagagctaaggccttcccggttgttaaagatcttatggttgatagatcagctttc
gatcaaatcatggcagctggtggatacgttaacgtcaacactggaaacgctccagatgga
aactcaatcctaatcggtcacgaagaagcagaactagcgatggacgctgccgcttgtatc
ggttgtggtgcctgtgtagcaagctgtaagaatgcttcagcaatgctttttgttgctgcc
aaagtttctcaacttgctcttcttccgcaaggacaagttgaagctgaacatagagcttta
gctatggttgaaaaaatggatgagcttgggttcggaaactgtacgaacgaagctgagtgt
gaagctcaatgtccgaagggaattaagcttgataacatcgcacgtatgaatcgtggtgtt
gttcaagggattttcgctgctaggaagtaa

DBGET integrated database retrieval system