KEGG   Bacteriovorax stolpii: C0V70_07850Help
Entry
C0V70_07850       CDS       T05263                                 

Gene name
sdhA
Definition
(GenBank) succinate dehydrogenase flavoprotein subunit
  KO
K00239  succinate dehydrogenase / fumarate reductase, flavoprotein subunit [EC:1.3.5.1 1.3.5.4]
Organism
bsto  Bacteriovorax stolpii
Pathway
bsto00020  Citrate cycle (TCA cycle)
bsto00190  Oxidative phosphorylation
bsto00650  Butanoate metabolism
bsto01100  Metabolic pathways
bsto01110  Biosynthesis of secondary metabolites
bsto01120  Microbial metabolism in diverse environments
bsto01130  Biosynthesis of antibiotics
bsto01200  Carbon metabolism
Brite
KEGG Orthology (KO) [BR:bsto00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    C0V70_07850 (sdhA)
   00650 Butanoate metabolism
    C0V70_07850 (sdhA)
  09102 Energy metabolism
   00190 Oxidative phosphorylation
    C0V70_07850 (sdhA)
Enzymes [BR:bsto01000]
 1. Oxidoreductases
  1.3  Acting on the CH-CH group of donors
   1.3.5  With a quinone or related compound as acceptor
    1.3.5.1  succinate dehydrogenase
     C0V70_07850 (sdhA)
    1.3.5.4  fumarate reductase (quinol)
     C0V70_07850 (sdhA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: FAD_binding_2 Succ_DH_flav_C Pyr_redox_2 DAO GIDA NAD_binding_8 AlaDh_PNT_C HI0933_like FAD_binding_3 Pyr_redox YjeF_N
Motif
Other DBs
NCBI-ProteinID: AUN98022
UniProt: A0A2K9NRA2
LinkDB All DBs
Position
complement(1576506..1578443)
Genome map
AA seq 645 aa AA seqDB search
MTTPADKIKKLDGKVPAGAISEKWKNHKFHMKIVNPANKRKYSVIIVGTGLAGGSAAASL
AELGYHVTTFCIQDSPRRAHSIAAQGGINAAKNYPNDGDSVYRLFYDTVKGGDYRAREAN
VHRLAEVANNIIDQCVAQGVPFAREYGGTLSNRSFGGSQVSRTFYARGQTGQQLLLGAYS
AMMKEVNNGKVKSLTRREMVELVIVNGKARGIITRNLVTGEFERHMADAVILATGGYGNV
FYLSTNAKASNASAAFRAYKKGAYFGNPCFTQIHPTCIPVSGDHQSKLTLMSESLRNDGR
VWVPKKKGDTRKPQDIPEEERDYYLERIYPSFGNLVPRDVASRNAKNMCDAGFGVGATGL
AVYLDFSSAIKRDGIDKIREKYGNLFDMYQQITDQDPYKTPMMIYPAIHYTMGGLWVDYN
LMSNIEGLFVLGEANFSDHGANRLGASALMQGLADGYFVIPYTIGDYFASNKFEKLETSH
PEFEKALKNSKEKYDRLLAINGTKTVDDFHKELGKVMWDHVGMARNEQGLKKAIDQIRSI
RERFWKDVKVTGSNVDVNTELEKAGRVADFLELGELMALDALMRPESCGGHFREESQTEE
GEAKRDDENYCHVAAWEYQGDGVEPLRHIEELKFENVKLTQRSYK
NT seq 1938 nt NT seq  +upstreamnt  +downstreamnt
atgacaactccagctgataaaattaaaaaactagacgggaaagttcctgcaggagctatt
tctgaaaaatggaaaaaccataaattccacatgaaaatcgtcaaccctgctaacaagaga
aaatactctgttatcatcgttggaacagggctcgctggtggatctgctgccgcttctctg
gccgaactagggtatcatgtcacaactttctgtatccaggattcaccaagacgcgctcac
tcgattgccgctcaaggtggtatcaacgctgctaaaaactatccaaacgatggggactct
gtttaccgcctattctacgacactgtaaaaggtggagattaccgcgctcgtgaagcaaac
gttcaccgtcttgctgaagtcgctaacaacatcatcgatcagtgtgttgctcaaggtgta
ccattcgctcgtgaatacggtggaactctttcaaacagatctttcggtggatctcaagta
tcaagaactttctatgcccgtggacaaacagggcaacagcttctcttaggtgcatactct
gcaatgatgaaagaagtgaataacggaaaagtaaaatcacttactcgccgtgaaatggtt
gagctagttatcgttaacggtaaagctcgcggtatcatcacaagaaaccttgtgactggt
gagttcgagcgccacatggccgacgctgtaatcttagctacaggtggatacggaaacgtg
ttctatctttctacaaacgctaaggcttcaaacgcttcagctgcattccgcgcttacaaa
aaaggtgcttatttcggaaacccatgtttcacgcaaattcaccctacatgtatcccggtt
tcaggtgatcaccaatcgaaactgactctaatgtctgagtctcttcgtaacgacggacgc
gtttgggttccaaagaaaaaaggcgacacaagaaagccacaggatattcctgaagaagaa
agagattactacctagagagaatttatccatcatttggtaaccttgttcctcgtgacgta
gcttcaagaaacgcgaagaatatgtgcgatgctggttttggtgtcggggccacaggtctg
gccgtttacctggatttctcttctgcaattaagcgcgatggtatcgataaaatcagagaa
aaatacggaaacctttttgatatgtaccaacagattacagatcaagacccgtacaaaact
ccgatgatgatctaccctgctatccactacacaatgggtggtctatgggttgactataac
cttatgtcaaacatcgaaggtctattcgttcttggagaagcaaacttctctgaccacgga
gcaaaccgccttggagcttctgctctaatgcaaggtctagctgacgggtacttcgttatc
ccgtacacaatcggtgattacttcgcttcaaacaaattcgaaaagcttgagacatctcac
cctgaatttgaaaaagcattgaagaactcaaaagaaaaatacgacaggctactggcaatc
aacggaacaaaaacggttgatgatttccacaaagagcttggaaaagttatgtgggatcac
gttggtatggcgagaaatgagcaaggtctaaagaaggccattgatcaaatcagaagcatc
cgcgagagattctggaaagatgtaaaagtaactggatcaaatgttgacgttaacactgag
cttgagaaagctggtcgagttgctgacttcttagagcttggggagcttatggcccttgat
gctctaatgagacctgaatcatgtggtggacacttcagagaagagtctcaaactgaagaa
ggtgaagcaaaacgcgatgacgagaactactgtcacgttgctgcttgggaataccaaggc
gacggcgtagagccacttcgtcacattgaagaactgaagtttgagaacgtaaaactaaca
caaagatcttacaagtaa

DBGET integrated database retrieval system