KEGG   Bacteriovorax stolpii: C0V70_12230Help
Entry
C0V70_12230       CDS       T05263                                 

Definition
(GenBank) hypothetical protein
  KO
K07259  serine-type D-Ala-D-Ala carboxypeptidase/endopeptidase (penicillin-binding protein 4) [EC:3.4.16.4 3.4.21.-]
Organism
bsto  Bacteriovorax stolpii
Pathway
bsto00550  Peptidoglycan biosynthesis
Brite
KEGG Orthology (KO) [BR:bsto00001]
 09100 Metabolism
  09107 Glycan biosynthesis and metabolism
   00550 Peptidoglycan biosynthesis
    C0V70_12230
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01002 Peptidases [BR:bsto01002]
    C0V70_12230
   01011 Peptidoglycan biosynthesis and degradation proteins [BR:bsto01011]
    C0V70_12230
Enzymes [BR:bsto01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.16  Serine-type carboxypeptidases
    3.4.16.4  serine-type D-Ala-D-Ala carboxypeptidase
     C0V70_12230
   3.4.21  Serine endopeptidases
    3.4.21.-  
     C0V70_12230
Peptidases [BR:bsto01002]
 Serine Peptidases
  Family S13: D-Ala-D-Ala peptidase C family
   C0V70_12230
Peptidoglycan biosynthesis and degradation proteins [BR:bsto01011]
 Peptidoglycan biosynthesis and degradation
  DD-Carboxypeptidase/DD-Endopeptidase (Low molecular weight PBP)
   C0V70_12230
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Peptidase_S13
Motif
Other DBs
NCBI-ProteinID: AUN98855
UniProt: A0A2K9NUU5
LinkDB All DBs
Position
2492871..2494277
Genome map
AA seq 468 aa AA seqDB search
MVIEAIPLIHIFWGIHTFIMRGYYMKLSKKLTSVALLAMSASSVMASEATDKDFAQLLAK
YKLDAKEQSYCYTDENGKLQGSNVDTKVRLASVTKLITTLWAVEEKGPNYRYDTKLYIKG
NNLHIQGSFDPFMSNEKMLFLISQLNTLGYKHFDKITYDKTIQIFPNAQVHTDPYPLITR
DSNGKNIKLYFNTDSWSKVFRAEYDRLASLAKKDRFLKSVDMSADAVEFSEKNPLVEDIN
NVPEDVKVLTLTSPALYKYLKETNVKSNNYSSHTIFLDLGGAAKFEKWVADKFSITTDKL
KLWNGNGLPTVINGKRYDNYATCAVMAELIEALKESSERQGKEIEDVVAVPGSDAGTFAN
RLNSSDLKNTFVAKTGTLMHTSTLAGAMNTQKGYSFFGIFNQTTDITSAKQVQNAMVKSL
MDEMSGPKTFGYQVEGFHAYDNNENVKNFNIIDEEEATDFSSIEGSLQ
NT seq 1407 nt NT seq  +upstreamnt  +downstreamnt
atggtcatcgaggctatacccctcatacatattttttggggaatccacacattcatcatg
aggggctactatatgaaattatctaaaaaactaacaagcgtggcgcttttagctatgtcg
gcatcatcagttatggccagtgaagccactgataaagacttcgctcagcttttggccaag
tacaaactagacgcaaaagagcagtcgtattgttacacagatgaaaacggaaaacttcaa
ggctcaaacgtagacacaaaggtacgtttagcttcagttacaaaattaattacaactctt
tgggcggttgaagaaaaaggtccaaactaccgttacgatacaaaactttatatcaaagga
aataacctgcacattcaagggtctttcgatcctttcatgagcaacgaaaaaatgcttttc
cttatctctcagttaaacactctagggtacaagcactttgataaaatcacttacgataaa
acgattcaaatcttcccgaacgctcaggttcacacggacccataccctcttattacaaga
gactctaacgggaagaacattaagctttatttcaacacagactcttggtcaaaagtgttt
agagcagaatacgatcgtctagcttctctagctaaaaaagaccgtttcttaaaatctgtt
gatatgagcgcagacgctgttgagttctcagagaaaaaccctctggtagaagacatcaac
aatgttccggaagatgttaaagttttaactctaacttctccagctctttataaatacctt
aaagaaacaaacgttaagtcgaacaactactcttctcacaccatcttccttgatcttggt
ggagcagctaagtttgagaaatgggttgcagataagttcagtatcacaactgataagtta
aaactgtggaatggaaatggtcttccaacagttattaacggaaaaagatacgacaactac
gcaacttgtgcagtcatggccgagctaattgaagctctaaaagagtcatctgaaagacaa
ggaaaagaaattgaagacgtggttgcagttccaggaagtgacgccggtacatttgctaac
cgtctaaactcaagtgacctaaaaaacactttcgtagcgaagactggtacgttaatgcac
acatcgactcttgctggggcgatgaacacgcaaaagggatacagcttctttggtatcttc
aaccagacgacagacatcacaagcgcaaaacaagttcaaaacgcgatggtaaagtctcta
atggatgaaatgagtggtccaaaaacatttggttaccaggtagaaggtttccacgcttac
gacaacaacgaaaatgttaagaacttcaacattatcgatgaagaagaagctactgacttc
agctctatcgaaggatctcttcagtaa

DBGET integrated database retrieval system