KEGG   Bacillus subtilis subsp. subtilis 168: BSU00690
Entry
BSU00690          CDS       T00010                                 
Symbol
ftsH
Name
(RefSeq) ATP-dependent zinc metalloprotease FtsH
  KO
K03798  cell division protease FtsH [EC:3.4.24.-]
Organism
bsu  Bacillus subtilis subsp. subtilis 168
Brite
KEGG Orthology (KO) [BR:bsu00001]
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01002 Peptidases and inhibitors [BR:bsu01002]
    BSU00690 (ftsH)
  09182 Protein families: genetic information processing
   03110 Chaperones and folding catalysts [BR:bsu03110]
    BSU00690 (ftsH)
Enzymes [BR:bsu01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.24  Metalloendopeptidases
    3.4.24.-
     BSU00690 (ftsH)
Peptidases and inhibitors [BR:bsu01002]
 Metallo peptidases
  Family M41: FtsH endopeptidase family
   BSU00690 (ftsH)
Chaperones and folding catalysts [BR:bsu03110]
 Other chaperones and cochaperones
  AAA proteases
   BSU00690 (ftsH)
SSDB
Motif
Pfam: Peptidase_M41 AAA FtsH_ext AAA_lid_3 AAA_22 AAA_5 TIP49 AAA_16 RuvB_N LonB_AAA-LID AAA_33 IstB_IS21 DUF6404 Mg_chelatase AAA_14 AAA_7 YMF19 DUF815 AAA_17 MscL
Other DBs
NCBI-GeneID: 938094
NCBI-ProteinID: NP_387950
Pasteur: BG10132
BSORF: BG10132
UniProt: P37476 A0A6M3Z6F8
LinkDB
Position
76984..78897
AA seq 637 aa
MNRVFRNTIFYLLILLVVIGVVSYFQTSNPKTENMSYSTFIKNLDDGKVDSVSVQPVRGV
YEVKGQLKNYDKDQYFLTHVPEGKGADQIFNALKKTDVKVEPAQETSGWVTFLTTIIPFV
IIFILFFFLLNQAQGGGSRVMNFGKSKAKLYTEEKKRVKFKDVAGADEEKQELVEVVEFL
KDPRKFAELGARIPKGVLLVGPPGTGKTLLAKACAGEAGVPFFSISGSDFVEMFVGVGAS
RVRDLFENAKKNAPCLIFIDEIDAVGRQRGAGLGGGHDEREQTLNQLLVEMDGFSANEGI
IIIAATNRADILDPALLRPGRFDRQITVDRPDVIGREAVLKVHARNKPLDETVNLKSIAM
RTPGFSGADLENLLNEAALVAARQNKKKIDARDIDEATDRVIAGPAKKSRVISKKERNIV
AYHEGGHTVIGLVLDEADMVHKVTIVPRGQAGGYAVMLPREDRYFQTKPELLDKIVGLLG
GRVAEEIIFGEVSTGAHNDFQRATNIARRMVTEFGMSEKLGPLQFGQSQGGQVFLGRDFN
NEQNYSDQIAYEIDQEIQRIIKECYERAKQILTENRDKLELIAQTLLKVETLDAEQIKHL
IDHGTLPERNFSDDEKNDDVKVNILTKTEEKKDDTKE
NT seq 1914 nt   +upstreamnt  +downstreamnt
atgaatcgggtcttccgtaataccattttttatttacttattttattagtagtaatcggg
gttgtgagctacttccagacctcaaatccgaaaacagaaaatatgtcgtacagtacgttc
atcaaaaacctggatgacgggaaagttgatagcgtatcggttcagcctgtcagaggtgtt
tatgaggtaaaagggcagctgaaaaactacgacaaagatcaatactttttgactcatgtt
cctgaaggaaagggagcagaccagatatttaacgctttgaaaaagacagacgtaaaggtt
gagcccgcgcaagaaacaagcggatgggtgacgttcctgacgaccatcatcccatttgtc
attatctttattctgtttttcttcctgctcaatcaggctcaaggcggcggcagccgtgtc
atgaactttggcaagagtaaagcgaagctgtatacagaggaaaagaaacgcgtcaaattt
aaagacgttgcaggggctgacgaagaaaagcaagaacttgttgaagttgttgagtttctg
aaagatccccgcaagtttgccgagctcggcgccagaataccgaaaggcgtgcttttagtc
ggacctccgggtaccggtaaaacattgcttgccaaggcttgtgcaggagaagccggcgta
cctttcttcagcatcagcggatctgatttcgttgaaatgtttgtaggggtcggtgcttcc
cgtgtgcgtgacttgtttgaaaatgcgaaaaagaatgcgccttgtttgatcttcattgat
gaaattgacgcagtcggacgccagcgtggcgctggtctcggcggtggacacgatgaacgt
gaacagacgctaaaccaattgcttgttgaaatggacggattcagcgctaatgaaggaatt
atcatcattgctgcgacgaaccgtgcggacatcttggacccagccttacttcgtccggga
cgttttgaccgtcaaatcacagtggaccgcccagatgtcattggccgtgaagctgtattg
aaagtccatgcgagaaacaaaccgctggatgaaacggttaacctaaaatcaattgccatg
agaacaccaggcttctcaggcgctgacttagaaaacctcttgaatgaagctgcgcttgta
gcggctcgtcaaaacaagaaaaaaatcgatgcgcgtgatattgacgaagcgacggaccgt
gtaattgccggacccgctaagaagagccgcgttatctccaagaaagaacgcaatatcgtg
gcttatcacgaaggcggacacaccgttatcggtctcgttttagatgaggcagatatggtt
cataaagtaacgattgttcctcggggccaggctggcggttatgctgttatgctgccaaga
gaagaccgttatttccaaacaaagccggagctgcttgataaaattgtcggcctcttgggc
ggacgtgttgctgaagagattatcttcggtgaagtcagcacaggggcgcacaatgacttc
cagcgtgcgacgaatattgcaagacgaatggttacagaattcggtatgtcagaaaaactg
ggaccgttgcaatttggacagtctcagggcggtcaggtattcttaggccgtgatttcaac
aacgaacagaactacagtgatcaaatcgcttacgaaattgatcaggaaattcagcgcatc
atcaaagaatgttatgagcgtgcgaaacaaatcctgactgaaaatcgtgacaagcttgaa
ttgattgcccaaacgcttctgaaagttgaaacgcttgacgctgaacaaatcaaacacctt
atcgatcatggaacattacctgagcgtaatttctcagatgatgaaaagaacgatgatgtg
aaagtaaacattctgacaaaaacagaagaaaagaaagacgatacgaaagagtaa

DBGET integrated database retrieval system