KEGG   Bacillus subtilis subsp. subtilis 168: BSU01450
Entry
BSU01450          CDS       T00010                                 

Gene name
cbiO
Definition
(RefSeq) energy-coupling factor transporter ATP-binding protein EcfA1
  KO
K16786  energy-coupling factor transport system ATP-binding protein [EC:7.-.-.-]
Organism
bsu  Bacillus subtilis subsp. subtilis 168
Pathway
bsu02010  ABC transporters
Brite
KEGG Orthology (KO) [BR:bsu00001]
 09130 Environmental Information Processing
  09131 Membrane transport
   02010 ABC transporters
    BSU01450 (cbiO)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:bsu02000]
    BSU01450 (cbiO)
Transporters [BR:bsu02000]
 ABC transporters, prokaryotic type
  Metallic cation, iron-siderophore and vitamin B12 transporters
   Energy-coupling factor transporter
    BSU01450 (cbiO)
SSDB
Motif
Pfam: ABC_tran SMC_N AAA_22 AAA_21 AAA_29 ABC_ATPase AAA Mg_chelatase AAA_23 AAA_30 AAA_16 AAA_15 SbcCD_C AAA_33 MMR_HSR1 RsgA_GTPase AAA_18 AAA_13 NB-ARC CobA_CobO_BtuR NACHT CshA_repeat
Other DBs
NCBI-GeneID: 938925
NCBI-ProteinID: NP_388026
Pasteur: BG11067
BSORF: BG11067
UniProt: P40735 A0A6M4JEU5
LinkDB
Position
150443..151288
AA seq 281 aa
MNQNQLISVEDIVFRYRKDAERRALDGVSLQVYEGEWLAIVGHNGSGKSTLARALNGLIL
PESGDIEVAGIQLTEESVWEVRKKIGMVFQNPDNQFVGTTVRDDVAFGLENNGVPREEMI
ERVDWAVKQVNMQDFLDQEPHHLSGGQKQRVAIAGVIAARPDIIILDEATSMLDPIGREE
VLETVRHLKEQGMATVISITHDLNEAAKADRIIVMNGGKKYAEGPPEEIFKLNKELVRIG
LDLPFSFQLSQLLRENGLALEENHLTQEGLVKELWTLQSKM
NT seq 846 nt   +upstreamnt  +downstreamnt
atgaatcaaaatcagttgatatcggtagaggatatcgtatttcgatatcggaaggacgca
gaaagacgagcactagacggcgtctccctgcaggtgtatgagggtgaatggcttgcaatc
gtaggtcataacggttcagggaaatcaacactggcccgggcattgaatggtttaattctt
cctgaatcaggcgacattgaggttgccgggattcaattgacagaggaatctgtttgggaa
gtgcgtaagaagataggtatggtctttcaaaatccggataaccaatttgtcggaacgact
gttcgcgatgatgtggcttttggtttagaaaacaatggtgtaccgcgggaagaaatgatt
gagagagtagactgggcagtaaaacaggtgaatatgcaagattttctcgatcaagagccg
caccatctctccggaggccaaaagcagagagttgcgattgcgggggttattgccgcacgt
cctgatattattatcttagatgaagcaacatccatgcttgatccgatcgggcgagaagaa
gtgcttgaaacggtaagacatttaaaagagcagggcatggcgactgtcatatccattaca
catgacctgaatgaggcagcaaaagcagacaggatcattgtcatgaatggcggtaaaaaa
tatgctgaagggccgcctgaagagatttttaaattgaataaagaacttgttcgaattggg
cttgatttacccttctcattccagcttagccagcttttaagagaaaatggactggctttg
gaagaaaaccatttgactcaggaagggctggtgaaagagctgtggacattacaatcaaag
atgtag

DBGET integrated database retrieval system