KEGG   Bacillus subtilis subsp. subtilis 168: BSU01460
Entry
BSU01460          CDS       T00010                                 
Symbol
cbiO
Name
(RefSeq) energy-coupling factor transporter ATP-binding protein EcfA2
  KO
K16787  energy-coupling factor transport system ATP-binding protein [EC:7.-.-.-]
Organism
bsu  Bacillus subtilis subsp. subtilis 168
Pathway
bsu02010  ABC transporters
Brite
KEGG Orthology (KO) [BR:bsu00001]
 09130 Environmental Information Processing
  09131 Membrane transport
   02010 ABC transporters
    BSU01460 (cbiO)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:bsu02000]
    BSU01460 (cbiO)
Transporters [BR:bsu02000]
 ABC transporters, prokaryotic type
  Metallic cation, iron-siderophore and vitamin B12 transporters
   Energy-coupling factor transporter
    BSU01460 (cbiO)
SSDB
Motif
Pfam: ABC_tran AAA_21 SMC_N AAA_15 AAA_29 AAA_22 AAA_16 RsgA_GTPase AAA_30 ABC_ATPase NACHT Mg_chelatase MMR_HSR1 GTP_EFTU Dynamin_N AAA_25 DUF87 FtsK_SpoIIIE AAA_33 T2SSE AAA_8 PduV-EutP AAA_23 AAA_18 ATP_bind_1 DLIC
Other DBs
NCBI-GeneID: 938922
NCBI-ProteinID: NP_388027
Pasteur: BG11989
BSORF: BG11989
UniProt: P70970
LinkDB
Position
151303..152133
AA seq 276 aa
MKTPFERLALYDINASIKEGSYVAVIGHTGSGKSTLLQHLNGLLKPTKGQISLGSTVIQA
GKKNKDLKKLRKKVGIVFQFPEHQLFEETVLKDISFGPMNFGVKKEDAEQKAREMLQLVG
LSEELLDRSPFELSGGQMRRVAIAGVLAMDPEVLVLDEPTAGLDPRGRKEIMDMFYELHQ
RGNLTTILVTHSMEDAAAYADEMIVMHKGTIQASGSPRDLFLKGEEMAGWGLDLPETIKF
QRHLEAALGVRFNEPMLTIEDAAAEIRALFQGEKTL
NT seq 831 nt   +upstreamnt  +downstreamnt
atgaagaccccgtttgagcgcctagcactgtatgatatcaatgcatcgattaaagaagga
agctacgtagccgttatcgggcatacaggctctggcaagtccactcttctacagcaccta
aatggtctcctgaagccgacgaagggacagatatcactaggcagcactgtcattcaggca
gggaaaaagaataaagatctgaaaaaacttcgtaaaaaagtcggaatcgttttccaattt
cctgagcatcaattattcgaagaaacagttcttaaagatatttcattcggaccgatgaac
tttggtgttaaaaaagaagatgctgaacaaaaagcgagagagatgctgcagcttgtaggt
ttatcagaagagcttttggacaggtcaccctttgaattaagcgggggacaaatgcgcaga
gttgcaattgccggcgtacttgcaatggaccctgaagtgcttgttctggatgaaccgact
gcaggattggacccaagagggcgaaaagagattatggacatgttttatgagcttcatcaa
cgtgggaacttgacgacgatccttgtgacacacagcatggaggatgcagctgcatacgct
gatgaaatgattgttatgcataaaggaacgatacaagcatcaggcagtccgcgtgatctg
tttttaaagggtgaagagatggccggctgggggctggatcttcctgaaacaataaaattc
caaagacaccttgaagctgcactgggtgtgagatttaatgagcctatgctcacaatcgaa
gatgccgctgccgaaatccgtgctctttttcagggagagaagactttatga

DBGET integrated database retrieval system