KEGG   Bacillus subtilis subsp. subtilis 168: BSU02130
Entry
BSU02130          CDS       T00010                                 

Gene name
glpQ
Definition
(RefSeq) glycerophosphoryl diester phosphodiesterase
  KO
K01126  glycerophosphoryl diester phosphodiesterase [EC:3.1.4.46]
Organism
bsu  Bacillus subtilis subsp. subtilis 168
Pathway
bsu00564  Glycerophospholipid metabolism
Brite
KEGG Orthology (KO) [BR:bsu00001]
 09100 Metabolism
  09103 Lipid metabolism
   00564 Glycerophospholipid metabolism
    BSU02130 (glpQ)
Enzymes [BR:bsu01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.4  Phosphoric-diester hydrolases
    3.1.4.46  glycerophosphodiester phosphodiesterase
     BSU02130 (glpQ)
SSDB
Motif
Pfam: GDPD GDPD_2
Other DBs
NCBI-GeneID: 938446
NCBI-ProteinID: NP_388095
Pasteur: BG10646
BSORF: BG10646
UniProt: P37965 A0A6M3Z6Y0
LinkDB
Structure
PDB: 
5T9C 5T91 5T9B

Position
complement(233014..233895)
AA seq 293 aa
MRKNRILALFVLSLGLLSFMVTPVSAASKGNLLSPDRILTVAHRGASGYVPEHTILSYET
AQKMKADFIELDLQMTKDGKLIVMHDEKLDRTTNGMGWVKDHTLADIKKLDAGSWFNEAY
PEKAKPQYVGLKVPTLEEVLDRFGKHANYYIETKSPDTYPGMEEKLIASLQKHKLLGKHS
KPGQVIIQSFSKESLVKVHQLQPNLPTVQLLEAKQMASMTDAALEEIKTYAVGAGPDYKA
LNQENVRMIRSHGLLLHPYTVNNEADMHRLLDWGVTGVFTNYPDLFHKVKKGY
NT seq 882 nt   +upstreamnt  +downstreamnt
atgagaaaaaatagaatactggccttgtttgttctgtcgctgggcttactctcatttatg
gtaacgccagtgtcggcagcgtcaaaaggaaacctgctgtcacctgaccgtatcctgacc
gtcgcgcacagaggggcttctggatatgtgcctgagcacacgattctgtcttacgaaacc
gctcagaaaatgaaagctgattttattgaattggatctgcaaatgacaaaagacggaaaa
ttgattgtcatgcatgacgaaaaactggaccgcaccacaaacggaatgggttgggtgaaa
gaccatacgctcgcagacattaagaagcttgacgccggttcttggtttaatgaagcctat
ccggaaaaagcaaagccgcagtacgtcggccttaaagttcctacattagaagaggtatta
gaccgtttcggaaagcacgcgaactactacattgaaacaaaatcgcctgacacctaccca
ggtatggaagaaaaactgatcgcttctttgcagaaacataaattactgggaaagcattct
aagccaggccaggtgatcattcaatcgttcagcaaagaaagcctggtaaaagtccatcaa
ttacagccaaacctgccgaccgttcaattgctggaagccaaacaaatggcgtcaatgaca
gatgctgccctggaagaaatcaaaacatacgctgtcggtgcgggcccggattataaagct
ttaaatcaagaaaacgtccgtatgatccgcagccacggcctcctgcttcatccttacaca
gtcaataatgaagctgatatgcatcgcctgcttgattggggcgtaacaggagtgttcacc
aactatcctgatcttttccacaaagtaaaaaagggttattaa

DBGET integrated database retrieval system