KEGG   Bacillus subtilis subsp. subtilis 168: BSU02270
Entry
BSU02270          CDS       T00010                                 

Symbol
pssA
Name
(RefSeq) CDP-diacylglycerol--serine O-phosphatidyltransferase
  KO
K17103  CDP-diacylglycerol---serine O-phosphatidyltransferase [EC:2.7.8.8]
Organism
bsu  Bacillus subtilis subsp. subtilis 168
Pathway
bsu00260  Glycine, serine and threonine metabolism
bsu00564  Glycerophospholipid metabolism
bsu01100  Metabolic pathways
bsu01110  Biosynthesis of secondary metabolites
Module
bsu_M00093  Phosphatidylethanolamine (PE) biosynthesis, PA => PS => PE
Brite
KEGG Orthology (KO) [BR:bsu00001]
 09100 Metabolism
  09103 Lipid metabolism
   00564 Glycerophospholipid metabolism
    BSU02270 (pssA)
  09105 Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    BSU02270 (pssA)
Enzymes [BR:bsu01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.8  Transferases for other substituted phosphate groups
    2.7.8.8  CDP-diacylglycerol---serine O-phosphatidyltransferase
     BSU02270 (pssA)
SSDB
Motif
Pfam: CDP-OH_P_transf
Other DBs
NCBI-GeneID: 938427
NCBI-ProteinID: NP_388109
Pasteur: BG11012
BSORF: BG11012
UniProt: P39823 A0A6M4JCC6
LinkDB
Position
247744..248277
AA seq 177 aa
MNYIPCMITIGNFICGLLAIHSLLYHNIHSAVLFIFTGMFLDFFDGMAARKLNAVSDMGR
ELDSFADLVTFGVAPSMLAYSVALYTLPFIGILCALTYSICGMLRLSKFNIEQSKLPTFI
GMPIPFAGMCLVILSFTYNPILLAIGTCGLSYLMVSKIKFPHFKKHAAENLESGRWN
NT seq 534 nt   +upstreamnt  +downstreamnt
gtgaattacatcccctgtatgattacgataggaaacttcatttgcggattgctggcgatt
cattccttgctatatcacaacattcattcagcagtgctttttatttttacaggcatgttc
cttgatttctttgacgggatggctgctcgtaagctgaatgccgtttctgatatggggaga
gaactggattcgtttgccgatctggttacgtttggggtggctccttctatgcttgcttac
agtgtcgcgttgtataccctgccatttatcgggatcttatgcgcattgacgtacagcatt
tgcggaatgcttcgcctctctaaatttaacattgaacaaagcaagctcccgacgtttatc
ggtatgccgattccgtttgcgggcatgtgtctcgttattctaagcttcacctataacccg
atccttctggcaatcggcacttgcggactctcatatttgatggtgagtaaaataaaattc
cctcattttaaaaaacatgcggcagaaaacctggagtctgggagatggaattag

DBGET integrated database retrieval system