KEGG   Bacillus subtilis subsp. subtilis 168: BSU02320
Entry
BSU02320          CDS       T00010                                 

Gene name
ybfP
Definition
(RefSeq) AraC family transcriptional regulator
Organism
bsu  Bacillus subtilis subsp. subtilis 168
SSDB
Motif
Pfam: HTH_18 HTH_AraC
Other DBs
NCBI-GeneID: 938428
NCBI-ProteinID: NP_388114
Pasteur: BG12744
BSORF: BG12744
UniProt: O31456 A0A6M4JES0
LinkDB
Position
251427..252314
AA seq 295 aa
MYYEKAVQKTINWIESHLHEQISNEDIVNVSSFSKFHFHRIFQKEVGMSVASYIRLRRLA
NAAAALLYTDHRIIDIALYYQFESQEAFTRTFKKMYHMPPGAYRTFMKRFTSKKEESYME
KKMKGWVLSGSHPFQFEMGIDRENVHQGKASGYLKSTMVQDIGEFATMMQQFKADRYLGK
RLRLSSFIKTKGVQHFASLWMRVDSAADDVLQFDNMSNRPITGTTNWNHYAIVLDVPENS
AVISFGVQLSGPGQVWMDHVVFEEVDESVPSTNLEMPGELLDEPVNLSFEEELQK
NT seq 888 nt   +upstreamnt  +downstreamnt
atgtattatgaaaaagctgtccagaaaacaatcaattggattgaatcacatttacatgag
caaatatcaaacgaggatattgttaacgtttcaagcttttcaaaattccattttcatcgg
atttttcaaaaagaagtcggcatgtcggttgcttcttatattcggttaagacgtcttgcg
aatgcggcggcagctttgctttatacagatcatcgtattatcgatattgctttgtattat
cagtttgaatctcaagaagcatttacgaggacgttcaaaaagatgtatcacatgccgcca
ggagcataccgaacatttatgaaacgctttacttcaaaaaaggaggaatcttacatggag
aaaaaaatgaaaggctgggtattgagcgggagccatccgttccaattcgaaatggggatt
gaccgggaaaatgtacatcagggaaaagcttcagggtatttaaagtcaacgatggttcag
gatatcggtgaatttgcgacgatgatgcagcaattcaaagcagatcgctatctaggaaaa
aggcttcgtctatcaagttttatcaaaacaaagggggtgcagcattttgcctcactttgg
atgcgggttgacagtgctgctgatgatgttctccaatttgataatatgagcaacagacct
attaccggaacaaccaattggaatcattatgctatcgttttagatgtcccagaaaatagc
gctgtgatatcttttggcgttcaattatctgggccgggtcaggtgtggatggatcatgtt
gtttttgaagaggtagatgagagcgttccttcaacaaaccttgaaatgccgggagaactt
ttagatgaaccggtaaatttatcttttgaagaggaactacaaaaatag

DBGET integrated database retrieval system