KEGG   Bacillus subtilis subsp. subtilis 168: BSU02480Help
Entry
BSU02480          CDS       T00010                                 

Gene name
gudP
Definition
(RefSeq) glucarate transporter
  KO
K03535  MFS transporter, ACS family, glucarate transporter
Organism
bsu  Bacillus subtilis subsp. subtilis 168
Brite
KEGG Orthology (KO) [BR:bsu00001]
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:bsu02000]
    BSU02480 (gudP)
Transporters [BR:bsu02000]
 Major facilitator superfamily (MFS)
  Organic acid transporters
   Anion:cation symporter (ACS) family [TC:2.A.1.14]
    BSU02480 (gudP)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: MFS_1 Sugar_tr OATP TOBE_3
Motif
Other DBs
NCBI-GeneID: 938413
NCBI-ProteinID: NP_388130
Pasteur: BG11160
BSORF: BG11160
UniProt: P42237
LinkDB All DBs
Position
270396..271763
Genome map
AA seq 455 aa AA seqDB search
MKKDFASVTPAGKKTSVRWFIVFMLFLVTSINYADRATLSITGDSVQHDLGLDSVAMGYV
FSAFGWAYVIGQLPGGWLLDRFGSKTIIALSIFFWSFFTLLQGAIGFFSAGTAIILLFAL
RFLVGLSEAPSFPGNGRVVASWFPSSERGTASAFFNSAQYFAIVIFSPLMGWLTHSFGWH
SVFVVMGIAGILLAVIWLKTVYEPKKHPKVNEAELAYIEQGGGLISMDDSKSKQETESKW
PYIKQLLTNRMLIGVYIAQYCITTLTYFFLTWFPVYLVQARGMSILEAGFVASLPALCGF
AGGVLGGIVSDILLKKGRSLTFARKVPIIAGMLLSCSMIVCNYTDSAWLVVVIMSLAFFG
KGFGALGWAVVSDTSPKECAGLSGGLFNTFGNIASITTPIIIGYIVNATGSFNGALVFVG
ANAIAAILSYLLLVGPIKRVVLKKQEQDPDQSLPV
NT seq 1368 nt NT seq  +upstreamnt  +downstreamnt
atgaaaaaagactttgcgagtgttactccggcgggcaaaaaaacgtccgtgcgctggttc
atcgtgtttatgctgtttcttgtgacctctattaactacgcggatcgagcgacgctttcc
atcaccggagattccgtccagcacgatttgggattggactcggtcgccatgggatatgtc
ttttctgcctttggctgggcctatgtcatcggacagcttccgggcggctggctgctggac
cgttttggttcaaagactatcattgcgttaagcatctttttctggtcgttttttacgttg
ctgcaaggggcgattggctttttctccgccggcacagcgattatcctgctgtttgcactg
cgttttctggttggtttatcagaagcgccttcatttcccggaaacggcagagttgttgcc
tcatggtttccaagctccgagcgcgggacagcttcagccttttttaattcagcacaatac
ttcgcaatcgtcattttttctcctttaatgggctggcttacccactctttcggctggcat
tccgttttcgttgtcatgggtattgcaggcattcttctggctgtcatctggctaaaaacg
gtgtatgaaccgaaaaaacatccgaaggttaatgaagctgagcttgcgtacatcgaacag
ggcggcgggctgatttccatggatgacagtaaaagcaaacaagaaacagaatcgaaatgg
ccgtatatcaaacagctgttaacgaaccgcatgctgattggcgtgtacatcgcgcaatac
tgtattacgactctcacctatttctttctcacatggtttccggtatatttggttcaggcc
cgcggcatgtctattcttgaagctgggtttgtcgcttccctgccggcgctgtgcggattt
gccggcggcgtgcttgggggcattgtgtcagacatcttactcaaaaaaggccgttcactg
acctttgcaagaaaagtgccaatcattgccggcatgctgctgtcttgcagtatgattgtc
tgtaactacacagattcagcatggctcgtcgttgtcattatgtcgctcgcgtttttcgga
aaaggcttcggcgcattgggttgggctgtcgtgtcggacacgtctccgaaagaatgtgca
ggattaagcggcggtttgttcaacactttcgggaatattgcctcaattacaacaccgatt
attatcggatacattgtcaatgccactggatctttcaatggcgcgcttgtgtttgtcggc
gctaacgcgattgcggcgatcctcagctatttgctgctggtcgggccgatcaaacgggtc
gtgttaaagaaacaagaacaagaccccgatcaatcgttgcctgtctaa

DBGET integrated database retrieval system