KEGG   Bacillus subtilis subsp. subtilis 168: BSU02570
Entry
BSU02570          CDS       T00010                                 
Symbol
ycbN
Name
(RefSeq) ABC transporter ATP-binding protein
  KO
K01990  ABC-2 type transport system ATP-binding protein
Organism
bsu  Bacillus subtilis subsp. subtilis 168
Brite
KEGG Orthology (KO) [BR:bsu00001]
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:bsu02000]
    BSU02570 (ycbN)
Transporters [BR:bsu02000]
 ABC transporters, prokaryotic type
  ABC-2 type and other transporters
   ABC-2 type transporter
    BSU02570 (ycbN)
SSDB
Motif
Pfam: ABC_tran AAA_21 IstB_IS21 AAA_15 AAA_23 DUF4162 AAA_29 DUF6495 AAA_30 SRP54 cobW RsgA_GTPase ATP_bind_1 AAA_22 DO-GTPase2
Other DBs
NCBI-GeneID: 938404
NCBI-ProteinID: NP_388139
Pasteur: BG11169
BSORF: BG11169
UniProt: P42246 A0A6M3Z715
LinkDB
Position
280086..281009
AA seq 307 aa
MTYIVQTNGLTKTYQGKEVVSNVSMHIKKGEIYGFLGPNGAGKTTIMKMLTSLVKPTSGE
IIILGNKFTHTSYEVLGNIGSMIEYPIFYENLTAEENLDLHCEYMGYHNKKAIQEVLDMV
NLKQIDKKPVKTFSLGMKQRLGIARAILTKPDLLILDEPVNGLDPLGIKKIRQLFQVLSK
EYGMTLLISSHLLGEIEQIADTIGVIRDGRLLEEVSMEDVRGQNTEYIELVTPNQTRACF
VLEKELQLTNFKILNEKTIRIYEAEASQAAISKALILNDVDIESMNKKYTSLEDYFIKLI
NGNSISA
NT seq 924 nt   +upstreamnt  +downstreamnt
ttgacttatatcgtacaaacaaacgggctgaccaaaacatatcagggcaaagaggtcgta
tccaatgtcagcatgcatattaaaaaaggtgaaatctatggctttctcggcccgaacggc
gcggggaaaacaaccattatgaaaatgctgacgagccttgtcaaaccgacaagcggtgaa
atcatcatccttgggaacaagttcacccacacgtcatatgaggtgctggggaacatcggc
agcatgattgaatatccgattttttatgaaaacctgacagctgaagaaaatttagatctg
cattgtgaatatatgggataccacaataaaaaagccatacaagaagtgctggatatggtg
aatttaaaacaaatcgacaaaaaacccgtcaaaaccttttccctcgggatgaagcagcgc
cttggaattgcgcgtgccatcctcacgaagccggacctgcttattctggatgagccggtg
aatggtcttgaccctctcggcattaaaaagatcaggcaattgtttcaagtgctgagcaaa
gagtacgggatgacgctgctgatctcaagccacctgctgggtgaaatcgaacaaatcgcg
gacacaatcggcgtcattcgggacggcaggctgcttgaagaggtatcaatggaggatgtc
aggggccagaacactgaatacatcgagcttgtcacgccgaatcagacaagggcctgcttt
gtgctggagaaagagctgcaattaaccaactttaaaatattaaatgagaaaacgattcga
atttacgaggctgaagcctctcaggctgccatatccaaagcattgattttaaatgatgta
gacattgaatcaatgaacaaaaagtatacgtcgctggaggattattttatcaaattgatc
aacggcaatagcatcagtgcgtaa

DBGET integrated database retrieval system