KEGG   Bacillus subtilis subsp. subtilis 168: BSU03440
Entry
BSU03440          CDS       T00010                                 

Symbol
tlpC
Name
(RefSeq) methyl-accepting chemotaxis protein TlpC
  KO
K03406  methyl-accepting chemotaxis protein
Organism
bsu  Bacillus subtilis subsp. subtilis 168
Pathway
bsu02020  Two-component system
bsu02030  Bacterial chemotaxis
Brite
KEGG Orthology (KO) [BR:bsu00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   02020 Two-component system
    BSU03440 (tlpC)
 09140 Cellular Processes
  09142 Cell motility
   02030 Bacterial chemotaxis
    BSU03440 (tlpC)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02035 Bacterial motility proteins [BR:bsu02035]
    BSU03440 (tlpC)
Bacterial motility proteins [BR:bsu02035]
 Flagellar system
  Chemotaxis proteins
   MCPs
    BSU03440 (tlpC)
SSDB
Motif
Pfam: MCPsignal sCache_3_3 Cache_3-Cache_2 sCache_3_2 HAMP BLOC1_2 DUF2206 DUF4042 Laminin_II ATG17_like EzrA DUF3169 DUF1664 DUF4446 Mce4_CUP1 MAD NPV_P10
Other DBs
NCBI-GeneID: 938316
NCBI-ProteinID: NP_388226
Pasteur: BG10790
BSORF: BG10790
UniProt: P39209 A0A6M3Z7W5
LinkDB
Position
complement(372771..374492)
AA seq 573 aa
MLIKRFKMKLGTKILCLVFVVILLFSASVGTVMLKEITESMKQMATEKAKGDLALSSTYI
DDVMSGDWQVKNNKLYKGQTQINGNEDIVDLLGEKTGDTITIFQGDTRVATNVMKNGERA
VGTQASSEVIAAVLKKGKRFYGQADVAGSSYQTAYMPLKDQNGNIIGMLYTGANQSILAS
LTQSLFTQFAIVLVIVIMVSVILVLVFTRKINKRLNALKSAFESAGNGDMTIEVSDKTGD
ELSELSVYYNKMRMKLNDTIQTVQQSALQLASASQQLSAGAEETNQASEKITEAVQQIAN
GAQDQITRIENSESSLKQASADIRDISANTAAIADKGQLAQSKADIGQKEIANVQAQMDA
IHQSIQKSGEIIHQLDGRSKQIEQILSVITQIADQTNLLALNAAIEAARAGEQGKGFAVV
ADEVRKLAEESQQSAGQISKLIIEIQKDMNRSARSVEHVKTEAAEGVTMIQRTRDAFKEI
AAATGEISAEISDLSASVTNISASAHQINDSFAANTADIKESTKNTRQAAALTEEQFAAM
EEITAASETLSQLAEELTGIISQFKMINQAENG
NT seq 1722 nt   +upstreamnt  +downstreamnt
atgttgataaaacgatttaagatgaagctaggaactaaaattctttgcctcgttttcgtg
gtgattcttttgttttcggcatcagttggcactgtgatgcttaaggaaattacagaaagc
atgaaacaaatggcaactgaaaaagcgaaaggtgatctcgctttaagcagcacttatatt
gatgatgtcatgtcaggcgactggcaggtgaaaaacaataagctctataaagggcaaaca
caaatcaatggaaatgaagatattgttgatctgcttggtgaaaagacaggtgataccatt
accattttccaaggcgatactcgtgttgcaaccaatgtcatgaaaaatggcgaaagagcc
gtcggcacccaggcttcttctgaagttattgccgctgttttaaagaaaggaaagcgtttt
tacggacaagcagatgtagcaggttcttcttatcagactgcatacatgccgttaaaagat
caaaatgggaacatcatcggcatgctgtataccggagctaatcaaagtattttagcatca
cttacacaatcacttttcactcaattcgctatcgttcttgttatcgtcattatggtatca
gtcatccttgtcttggttttcaccagaaaaatcaacaagcggctgaacgctttaaaaagc
gcctttgaaagtgccggaaacggagatatgacaatagaggtgtcagacaaaaccggtgac
gagctttcagaactaagcgtctattataataagatgagaatgaagctgaacgataccata
caaaccgtacaacaatcagcccttcagcttgcgtcagcctctcagcagctctcagccgga
gcagaggaaacaaatcaagcttcagaaaaaatcacagaagctgtacagcagattgcaaat
ggagcccaagatcagatcacccgaattgaaaatagtgaaagctcattaaaacaagcttca
gcagacatccgggatatttctgcaaatactgccgctatcgctgacaaagggcagctcgct
caatcaaaagcagacattggacaaaaggaaattgcaaatgtacaggcgcaaatggatgcg
attcaccagtcaattcagaaaagcggagaaatcatacaccagttagacggccgctctaaa
caaattgagcaaattttatcggtcatcacccaaattgctgatcagacaaacctgcttgcg
ctgaatgcagcgattgaagctgccagagccggtgaacaaggaaaaggctttgctgttgtt
gctgatgaagtacggaaattagcagaagagtctcaacagtctgcggggcagatttcaaaa
ctgatcatagaaatacaaaaggatatgaaccggtctgcaagatctgttgagcatgtgaaa
acagaagctgcagaaggagtcaccatgatccagcgcaccagagatgcatttaaggaaatt
gcagctgcaacaggtgaaatcagcgccgagattagtgatttatcagcatctgtaacaaac
atttcagccagtgcacatcaaataaatgattcctttgcagccaatacggccgacattaaa
gaatctactaaaaatacccggcaagcggctgcattaacagaggagcaatttgctgcaatg
gaggagattaccgcagcttctgaaacactttctcaattagctgaggagcttaccggtatc
ataagccaatttaaaatgattaatcaagccgaaaacggctga

DBGET integrated database retrieval system