KEGG   Bacillus subtilis subsp. subtilis 168: BSU03590
Entry
BSU03590          CDS       T00010                                 
Symbol
tcyC
Name
(RefSeq) L-cystine import ATP-binding protein TcyC
  KO
K10010  L-cystine transport system ATP-binding protein [EC:7.4.2.1]
Organism
bsu  Bacillus subtilis subsp. subtilis 168
Pathway
bsu02010  ABC transporters
Brite
KEGG Orthology (KO) [BR:bsu00001]
 09130 Environmental Information Processing
  09131 Membrane transport
   02010 ABC transporters
    BSU03590 (tcyC)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:bsu02000]
    BSU03590 (tcyC)
Enzymes [BR:bsu01000]
 7. Translocases
  7.4  Catalysing the translocation of amino acids and peptides
   7.4.2  Linked to the hydrolysis of a nucleoside triphosphate
    7.4.2.1  ABC-type polar-amino-acid transporter
     BSU03590 (tcyC)
Transporters [BR:bsu02000]
 ABC transporters, prokaryotic type
  Phosphate and amino acid transporters
   Cystine transporter
    BSU03590 (tcyC)
SSDB
Motif
Pfam: ABC_tran AAA_21 SMC_N AAA_23 AAA_29 ABC_ATPase AAA_16 AAA_22 AAA_18 RsgA_GTPase AAA_28 AAA_24 ATPase_2 DO-GTPase2 NB-ARC AAA_30 NACHT DLIC AAA_14 TsaE AAA_15 PRK AAA_25 AAA_19 PduV-EutP AAA_33 cobW MobB RecA G-alpha T2SSE Mg_chelatase
Other DBs
NCBI-GeneID: 938294
NCBI-ProteinID: NP_388241
Pasteur: BG11185
BSORF: BG11185
UniProt: P39456 A0A6M4JCS1
LinkDB
Position
complement(409208..409951)
AA seq 247 aa
MLTVKGLNKSFGENEILKKIDMKIEKGKVIAILGPSGSGKTTLLRCLNALEIPNRGELAF
DDFSIDFSKKVKQADILKLRRKSGMVFQAYHLFPHRTALENVMEGPVQVQKRNKEEVRKE
AIQLLDKVGLKDKMDLYPFQLSGGQQQRVGIARALAIQPELMLFDEPTSALDPELVGEVL
KVIKDLANEGWTMVVVTHEIKFAQEVADEVIFIDGGVIVEQGPPEQIFSAPKEERTQRFL
NRILNPL
NT seq 744 nt   +upstreamnt  +downstreamnt
atgcttaccgttaaaggattaaacaaatcattcggtgaaaatgaaattttaaaaaagata
gatatgaagattgaaaaaggaaaagtcatcgccatacttgggccttcaggttcagggaaa
acgacgctgctccgctgcctgaacgctctggagatcccgaatcgcggagagcttgcattt
gatgatttctccatcgatttctccaaaaaggtgaaacaggcggatatcctaaagcttcgc
cgaaaatccggaatggtgtttcaggcgtatcacctgttcccgcaccgcacagccctcgaa
aacgtgatggagggccctgttcaggtgcaaaaacggaacaaagaggaagtcagaaaagaa
gcgattcagcttcttgataaagtcggattgaaggacaaaatggatttatatccgttccag
ctttccggcggccagcagcagcgcgtcggcatcgcccgcgcactggcgatacagcctgag
ctcatgctgtttgacgaaccgacctcagcgcttgatcccgagcttgtcggagaggtgctg
aaggttatcaaggacttggccaatgaaggctggaccatggtcgtcgtgacccacgaaatc
aagttcgcgcaggaggttgcggatgaagtcatcttcatcgacggcggcgttatcgtggag
cagggaccgccggagcaaattttctccgcaccaaaagaagaacggacacagcggttctta
aaccggattttgaacccgctgtaa

DBGET integrated database retrieval system