KEGG   Bacillus subtilis subsp. subtilis 168: BSU03730
Entry
BSU03730          CDS       T00010                                 
Symbol
yclH
Name
(RefSeq) ABC transporter ATP-binding protein
  KO
K02003  putative ABC transport system ATP-binding protein
Organism
bsu  Bacillus subtilis subsp. subtilis 168
Brite
KEGG Orthology (KO) [BR:bsu00001]
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:bsu02000]
    BSU03730 (yclH)
Transporters [BR:bsu02000]
 ABC transporters, prokaryotic type
  ABC-2 type and other transporters
   Putative ABC transporter
    BSU03730 (yclH)
SSDB
Motif
Pfam: ABC_tran SMC_N AAA_23 AAA_22 AAA_15 SbcC_Walker_B AAA_29 KDGP_aldolase ATPase AAA_25 AAA_24
Other DBs
NCBI-GeneID: 938289
NCBI-ProteinID: NP_388255
Pasteur: BG12029
BSORF: BG12029
UniProt: P94411 A0A6M4JF45
LinkDB
Position
complement(424208..424888)
AA seq 226 aa
MSLLQFQQVGYWYKNKSQPLFQDINISFQKGKFYTIVGTSGTGKTTFLSLAGGLDAPKEG
NILYDGKAVSKIGLTNFRNQYVSIVFQAYNLLPYMTALQNVTTAMEITGSKEKNKESYAL
DMLQKVGINEKQARQKVLTLSGGQQQRVSITRAFCCDTDLIVADEPTGNLDEDTSKEIVR
LFQDLAHKEDKCVIMVTHDEQIAKVSDINIRLSRGSFTVKENVAVV
NT seq 681 nt   +upstreamnt  +downstreamnt
atgagcttattacaatttcaacaagtcggctactggtataaaaacaaaagccagccattg
tttcaggatattaacatcagctttcaaaaaggaaaattctacacaatcgtcggaacatca
gggacggggaaaaccactttcctgtctctggcaggcggacttgacgcaccaaaagaagga
aacatcctttacgacggaaaagcggtttctaaaatcggcttaaccaatttcagaaatcaa
tatgtatcaatcgtctttcaggcgtacaacctgctcccgtatatgacggctttgcagaac
gtcacaaccgctatggaaatcacaggttctaaagaaaagaacaaagaatcatatgcgctt
gacatgctgcagaaggttggcatcaacgaaaaacaagcccggcaaaaagtgctcacactg
agcggcggacagcagcagcgggtatcaattacaagggctttctgctgtgacacggatctt
atcgtagccgatgaaccgaccggaaaccttgatgaggacacatcaaaagagatcgtacgg
ctctttcaggatctggcgcacaaggaagataaatgcgtcattatggtgacgcacgatgaa
caaattgcaaaagtgtcagacatcaatatcagactttcaagaggaagttttactgtgaag
gaaaacgtcgcagtcgtataa

DBGET integrated database retrieval system