KEGG   Bacillus subtilis subsp. subtilis 168: BSU03750
Entry
BSU03750          CDS       T00010                                 
Symbol
yclJ
Name
(RefSeq) transcriptional regulator
  KO
K02483  two-component system, OmpR family, response regulator
Organism
bsu  Bacillus subtilis subsp. subtilis 168
Brite
KEGG Orthology (KO) [BR:bsu00001]
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02022 Two-component system [BR:bsu02022]
    BSU03750 (yclJ)
Two-component system [BR:bsu02022]
 OmpR family
  Unclassified
   BSU03750 (yclJ)
SSDB
Motif
Pfam: Trans_reg_C Response_reg GerE
Other DBs
NCBI-GeneID: 938286
NCBI-ProteinID: NP_388257
Pasteur: BG12031
UniProt: P94413 A0A6M3Z803
LinkDB
Position
426577..427260
AA seq 227 aa
MKILMIEDNVSVCTMTEMFFFKEGFEAEFVHDGLEGYQRFTEENWDLIILDIMLPSMDGV
TICRKIRETSTVPIIMLTAKDTESDQVIGFEMGADDYVTKPFSPLTLVARIKAVIRRYKA
TGKAVIDEDMIETECFTINKKTREVLLNGEPVENLTPKEFDLLYYLVQNPRQVFSREQLL
EQVWGYQFYGDERTVDVHIKRLRKKLASEDKPFLYTVWGVGYKFDED
NT seq 684 nt   +upstreamnt  +downstreamnt
atgaaaatattaatgatagaagataatgttagtgtatgtacgatgacggagatgttcttt
tttaaagaaggttttgaagccgaattcgttcatgacgggttagaagggtaccagcgtttt
acggaagaaaattgggatctaatcattttggatatcatgcttccatctatggacggcgtg
accatctgcagaaaaataagagagacaagcacggtgccgattatcatgctgactgccaaa
gacactgaatcagatcaggtcatcggttttgagatgggggcggacgattatgtcacaaag
ccgttcagcccgctgacattggttgcccgcatcaaagccgtcatcagaagatataaggcg
acaggcaaagcggttattgatgaagatatgattgaaacggaatgctttaccattaataag
aagacgagagaagtattattaaacggagagcctgtagaaaatctcacgccgaaggaattc
gatctgctttattaccttgtccaaaatccgcggcaggtgttctccagagaacagctgctt
gagcaggtatggggctatcaattttatggagatgagcgaacggttgacgttcatatcaaa
cggctgcggaaaaagcttgccagcgaggacaagcctttcctgtatactgtgtggggagta
gggtataaatttgatgaagattaa

DBGET integrated database retrieval system