KEGG   Bacillus subtilis subsp. subtilis 168: BSU03820
Entry
BSU03820          CDS       T00010                                 
Symbol
yclP
Name
(RefSeq) ABC transporter ATP-binding protein
  KO
K25285  iron-siderophore transport system ATP-binding protein [EC:7.2.2.-]
Organism
bsu  Bacillus subtilis subsp. subtilis 168
Brite
KEGG Orthology (KO) [BR:bsu00001]
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:bsu02000]
    BSU03820 (yclP)
Transporters [BR:bsu02000]
 ABC transporters, prokaryotic type
  Metallic cation, iron-siderophore and vitamin B12 transporters
   Iron-siderophore transporter
    BSU03820 (yclP)
SSDB
Motif
Pfam: ABC_tran AAA_21 SMC_N AAA_15 AAA_29 AAA_14 RsgA_GTPase ATPase_2 AAA_23 AAA_30 AAA_16 ABC_ATPase Rad17 AAA_22 AAA_27 AAA_25
Other DBs
NCBI-GeneID: 938278
NCBI-ProteinID: NP_388264
Pasteur: BG12036
BSORF: BG12036
UniProt: P94420 A0A6M4JGB9
LinkDB
Position
434256..435014
AA seq 252 aa
MVEVRNVSKQYGGKVVLEETSVTIQKGKITSFIGPNGAGKSTLLSIMSRLIKKDSGEIYI
DGQEIGACDSKELAKKMSILKQANQINIRLTIKDLVSFGRFPYSQGRLTEEDWVHINQAL
SYMKLEDIQDKYLDQLSGGQCQRAFIAMVIAQDTDYIFLDEPLNNLDMKHSVEIMKLLKR
LVEELGKTIVIVIHDINFASVYSDYIVALKNGRIVKEGPPEEMIETSVLEEIYDMTIPIQ
TIDNQRIGVYFS
NT seq 759 nt   +upstreamnt  +downstreamnt
atggtagaggtcagaaatgtaagcaaacaatatggcgggaaagttgttcttgaagagacg
tcagtcacgattcaaaagggcaaaatcacctcgtttatcggtcctaacggcgccggcaaa
agtacgctgctgtctatcatgagccgcctgatcaaaaaggattccggcgagatttacata
gacggacaagagattggagcatgtgacagcaaagagcttgccaagaaaatgagcattttg
aagcaggcgaaccaaatcaatatcaggctcacgatcaaagacctcgtcagttttggcagg
tttccgtactcacagggccggctgacagaggaagactgggttcatatcaaccaggcgctt
agctatatgaagctggaagacattcaagacaaatacttggatcagctgagcggcggacag
tgccaaagggcatttatcgccatggtcattgcccaggacacagattatatctttctggat
gaaccgctgaacaatctggatatgaaacactcagttgaaattatgaaactgctgaaacgg
ctggtagaggagcttggaaaaacgatcgtgatcgtcattcacgatatcaattttgcttca
gtctattctgactatatcgtcgctttgaaaaacggccgaatcgttaaagaaggaccgcct
gaagaaatgatagaaacatcagtgcttgaggaaatctacgatatgaccatcccgattcag
acgattgataatcaaagaataggtgtttatttttcttaa

DBGET integrated database retrieval system