KEGG   Bacillus subtilis subsp. subtilis 168: BSU03890
Entry
BSU03890          CDS       T00010                                 

Symbol
gabR
Name
(RefSeq) GntR family transcriptional regulator
  KO
K00375  GntR family transcriptional regulator / MocR family aminotransferase
Organism
bsu  Bacillus subtilis subsp. subtilis 168
Brite
KEGG Orthology (KO) [BR:bsu00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03000 Transcription factors [BR:bsu03000]
    BSU03890 (gabR)
Transcription factors [BR:bsu03000]
 Prokaryotic type
  Helix-turn-helix
   GntR family
    BSU03890 (gabR)
SSDB
Motif
Pfam: Aminotran_1_2 GntR HTH_24 RPA_C HTH_36 Sigma70_r4_2 Fe_dep_repress Spectrin_like
Other DBs
NCBI-GeneID: 938271
NCBI-ProteinID: NP_388271
Pasteur: BG12042
BSORF: BG12042
UniProt: P94426 A0A6M4JFH9
Structure
LinkDB
Position
complement(440025..441464)
AA seq 479 aa
MDITITLDRSEQADYIYQQIYQKLKKEILSRNLLPHSKVPSKRELAENLKVSVNSVNSAY
QQLLAEGYLYAIERKGFFVEELDMFSAEEHPPFALPDDLKEIHIDQSDWISFSHMSSDTD
HFPIKSWFRCEQKAASRSYRTLGDMSHPQGIYEVRAAITRLISLTRGVKCRPEQMIIGAG
TQVLMQLLTELLPKEAVYAMEEPGYRRMYQLLKNAGKQVKTIMLDEKGMSIAEITRQQPD
VLVTTPSHQFPSGTIMPVSRRIQLLNWAAEEPRRYIIEDDYDSEFTYDVDSIPALQSLDR
FQNVIYMGTFSKSLLPGLRISYMVLPPELLRAYKQRGYDLQTCSSLTQLTLQEFIESGEY
QKHIKKMKQHYKEKRERLITALEAEFSGEVTVKGANAGLHFVTEFDTRRTEQDILSHAAG
LQLEIFGMSRFNLKENKRQTGRPALIIGFARLKEEDIQEGVQRLFKAVYGHKKIPVTGD
NT seq 1440 nt   +upstreamnt  +downstreamnt
atggatatcacgattacactcgatcgttcagaacaagccgattatatctatcagcaaatt
tatcaaaagctgaaaaaagaaatcctcagccgcaatctgctgccgcactcgaaggttccc
tccaagcgggagctggctgaaaatctcaaggtcagcgtaaattcagtgaattcagcctat
cagcagctgctggctgaggggtatttgtacgccattgaacgaaagggtttcttcgtggag
gaactagacatgttttccgccgaggagcaccctccatttgcactgccggatgacctaaaa
gagattcacatcgaccagagcgattggatatcgttttcacacatgagttccgatacagac
cattttccgatcaaaagctggttccgctgcgagcaaaaagcggcctcccgctcataccgc
acgctcggcgatatgtcacatccgcaagggatatatgaagtgagagcggccattacgagg
ctcatttccctgacgaggggtgtaaaatgcaggccggaacaaatgatcataggggcaggc
acacaggtgctcatgcagctgttgactgagcttttacccaaggaagccgtgtatgcgatg
gaggagcctggctacaggcgcatgtatcagcttttgaagaatgccggaaaacaagtaaag
acgatcatgctggatgaaaaaggcatgtcgattgctgaaatcaccagacagcagccagat
gtgctggtgaccaccccgtcgcatcagtttccgtccggaacgattatgcctgtatccaga
agaattcagctgctgaactgggcagccgaggagccgcgccgatatatcattgaggacgat
tatgatagtgaattcacatatgatgtagacagtattccggcgctgcaaagcctcgaccgt
tttcaaaatgtcatctatatgggaaccttttcaaagtcccttctccccggcttacggatc
agctatatggtgttgccgcctgagctgttgagggcatacaaacagcggggctatgatctg
cagacttgctcatcactcacacagctcaccctgcaggaatttatcgagtctggtgaatat
cagaagcatataaaaaaaatgaagcagcattataaagaaaagagagaacgcctgatcacc
gctttagaagcagagttcagcggagaggttaccgtaaaaggggcaaatgcggggctgcat
tttgttaccgaatttgataccaggcgcaccgaacaagacatcctgtcacatgctgccggg
ctgcagcttgaaatattcggaatgagccgatttaacttgaaggaaaacaagcggcaaacg
ggcaggcctgctctcattatcggctttgcacggctgaaggaagaagatattcaggagggt
gtgcagcggcttttcaaagcggtttacggacataaaaaaatccccgttacaggggattga

DBGET integrated database retrieval system