KEGG   Bacillus subtilis subsp. subtilis 168: BSU04160
Entry
BSU04160          CDS       T00010                                 

Symbol
mtlR
Name
(RefSeq) transcriptional regulator MtlR
  KO
K03483  mannitol operon transcriptional antiterminator
Organism
bsu  Bacillus subtilis subsp. subtilis 168
Brite
KEGG Orthology (KO) [BR:bsu00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03000 Transcription factors [BR:bsu03000]
    BSU04160 (mtlR)
Transcription factors [BR:bsu03000]
 Prokaryotic type
  Other transcription factors
   BglG family
    BSU04160 (mtlR)
SSDB
Motif
Pfam: PRD HTH_11 Mga HTH_DeoR PTS_EIIA_2 PTS_IIB HTH_Mga MarR Fe_dep_repress HTH_5 Flavodoxin_5 HTH_Tnp_ISL3 Sigma70_ECF PP-binding HTH_23 HTH_24 HTH_38
Other DBs
NCBI-GeneID: 938253
NCBI-ProteinID: NP_388297
Pasteur: BG12049
BSORF: BG12049
UniProt: P96574 A0A6M3Z813
LinkDB
Position
467130..469214
AA seq 694 aa
MYMTAREQKLLKHLLLQNRYITVTELAELMQVSTRTIHRELKSIKPLMETVGLTLDKQPG
KGLKAVGSPEGKQKLLTDLSYEQHEYSADERKLLILCSLLESQEPVKLYTLAHDLQVTNA
TVSYDLDELEKWISPFGLTLIRKRGFGIQLIGPENAKRKIVGNLIVNRLDIQMFLEAVEL
NIKGKTDSSEKMFGVVSKGELLKMERILFQLKEKIAFSLSDSSYIALVVHLTYAIERIKL
GETITMEQNELEELMNAKEYSSALEIAGELERAFGVTIPEAEVGYITIHLRSANRKYKTE
YKAQEIELETALQTKRLIAFISDKIRMDLTKNYSLYEGLIAHLEPAVSRIKENIEIYNPM
KEQIKRDYFLLYMAIEEGVEKYFPGMSFSDDEIAFIVLHFGSALEIKKEEAKVKALVVCS
SGIGSSKMLASRLKKELPEIESFDMSSLIELKGKDVQAYDMIVSTVPIPYENIDYIMVSP
LLNEEDANQVKQYIKRKIPLILNKKRSSKEEAQQADVPDMLEAAESIGRYMEVIQDVLRH
FTLAQLKTNPDHSMLLLELFQQLKKDGLIRDPEKAAVCLAEREKQGGLGIPGTNMALYHL
KNDEIVLPFFKMFDLSTPYEVDGMDGNTLRMTRILVMMAPGSLSAEGSEILSAISSAIIE
SGESMAGFQEEGGQELYQRLNRIFFTWMKEKNIL
NT seq 2085 nt   +upstreamnt  +downstreamnt
atgtatatgactgccagagaacaaaagctgttaaagcacttattattacaaaacagatat
ataaccgtaactgagcttgctgagctgatgcaagtcagcacgagaaccattcacagggaa
ctcaaatcaattaaaccgctgatggaaaccgtggggcttacgttagataaacagcccggt
aaagggttgaaagcagtgggaagtcccgagggtaaacaaaagctgcttactgatttatca
tatgaacagcatgaatacagcgccgacgaacggaaactgctcattctttgttcgttatta
gagtctcaggagcccgtcaaactgtacacgcttgctcatgatctccaggtgacgaatgcc
acggtcagctatgacttagatgagctcgagaagtggatttctccctttggactgacactg
atccgcaaaagaggttttggcatccagctcatagggccggagaatgcgaaacggaaaatt
gtcggcaacttgattgtgaaccgtctcgacatccaaatgtttttggaagcggttgaatta
aacatcaaaggaaaaaccgattcttcagagaaaatgttcggggttgtcagcaaaggtgag
ctgttaaaaatggagcgcatcttatttcagctcaaagaaaaaatcgctttttcattgtcc
gacagctcctatatagcgctcgtcgtccatctgacgtatgcgatcgaacgaattaagctt
ggggaaactatcaccatggagcaaaatgagcttgaggaactgatgaatgcgaaggaatac
agctccgctcttgaaatcgcgggcgagcttgaacgtgccttcggcgtgacgattccagag
gcggaggtcggctatattacaatccatcttcgaagcgccaatcgaaaatacaaaacagaa
tacaaagcgcaggaaattgagctggaaacagccctgcaaacaaagcggctcattgctttt
atttcagacaaaatcagaatggatctgacgaaaaactactctttatatgaaggcttgatt
gcccatttggagccggccgtcagccgcataaaagaaaatattgagatatacaatccgatg
aaggaacagatcaagcgcgattattttctgctttatatggcgatcgaagaaggtgtcgaa
aagtattttccgggcatgtccttttctgatgatgaaatcgcttttatcgttcttcacttt
ggctcggctcttgaaatcaaaaaagaagaagcaaaagtgaaagcgcttgtcgtctgctca
agcgggatcggctcctcgaaaatgcttgcctccagactgaaaaaagagctgccggaaatt
gaatcgtttgatatgtcatctctgatcgagctaaaggggaaggatgttcaagcctatgat
atgattgtgtccactgtaccgattccttatgaaaacattgattacatcatggtcagccca
ctattaaatgaggaagacgcaaaccaggtcaagcagtatatcaagcggaagattcccctt
attcttaacaaaaaaagaagctcgaaggaagaggcgcagcaagctgatgtacctgacatg
ctggaggcggcggaaagcatagggcggtatatggaagttatccaagatgttctgcgccat
tttacgctagctcaactcaaaacaaacccggaccatagcatgcttctgctagagcttttt
caacagctgaagaaggatggcctgatccgtgatccggaaaaagccgcggtttgcctggct
gagcgggagaaacaagggggattgggaatccccggaacaaacatggcgctttatcatctc
aaaaatgatgaaatcgtcctgccttttttcaaaatgtttgatctcagcaccccctatgaa
gtggatggcatggacggaaataccctcaggatgacacgcattctcgtcatgatggcgcct
ggctcattatctgctgaaggctcggagattttaagcgcgatcagctcggcaattatcgag
agcggagaaagcatggcggggtttcaggaagaaggaggacaagaattgtatcagcggtta
aaccgcatatttttcacatggatgaaagaaaaaaacatactgtaa

DBGET integrated database retrieval system