KEGG   Bacillus subtilis subsp. subtilis 168: BSU04250
Entry
BSU04250          CDS       T00010                                 
Symbol
lrpC
Name
(RefSeq) AsnC family transcriptional regulator
  KO
K03719  Lrp/AsnC family transcriptional regulator, leucine-responsive regulatory protein
Organism
bsu  Bacillus subtilis subsp. subtilis 168
Brite
KEGG Orthology (KO) [BR:bsu00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03000 Transcription factors [BR:bsu03000]
    BSU04250 (lrpC)
   03036 Chromosome and associated proteins [BR:bsu03036]
    BSU04250 (lrpC)
Transcription factors [BR:bsu03000]
 Prokaryotic type
  Helix-turn-helix
   Lrp/AsnC family
    BSU04250 (lrpC)
Chromosome and associated proteins [BR:bsu03036]
 Prokaryotic type
  Nucleoid associated proteins
   Other nucleoid associated proteins
    BSU04250 (lrpC)
SSDB
Motif
Pfam: AsnC_trans_reg HTH_24 HTH_AsnC-type MarR MarR_2 HTH_11 RPA_C HTH_9 Fe_dep_repress HTH_Crp_2 HTH_IclR LexA_DNA_bind HTH_5
Other DBs
NCBI-GeneID: 940147
NCBI-ProteinID: NP_388306
Pasteur: BG12056
UniProt: P96582 A0A6M3ZCU2
Structure
LinkDB
Position
476059..476493
AA seq 144 aa
MKLDQIDLNIIEELKKDSRLSMRELGRKIKLSPPSVTERVRQLESFGIIKQYTLEVDQKK
LGLPVSCIVEATVKNADYERFKSYIQTLPNIEFCYRIAGAACYMLKINAESLEAVEDFIN
KTSPYAQTVTHVIFSEIDTKNGRG
NT seq 435 nt   +upstreamnt  +downstreamnt
atgaaacttgaccagattgatctgaatatcattgaggagctgaagaaggacagccgtttg
tcgatgagggaattaggcagaaaaattaagctgtcgcctccatctgtaacagaacgggta
agacagcttgaatcgtttggcatcatcaagcaatacacgctggaggtcgaccagaaaaaa
ctggggcttcccgtttcctgcattgtggaagcaaccgttaaaaacgcggattatgagcgg
ttcaaaagctatattcaaacattgccgaatattgaattttgctaccggattgcgggtgca
gcctgctatatgctgaaaatcaatgccgaaagcctcgaagcggtagaagatttcattaac
aaaacatcgccctacgcgcaaaccgtcactcacgtcattttctcagaaattgacacgaaa
aacgggcgcggttag

DBGET integrated database retrieval system