KEGG   Bacillus subtilis subsp. subtilis 168: BSU04340
Entry
BSU04340          CDS       T00010                                 

Symbol
ydaP
Name
(RefSeq) thiamine pyrophosphate-containing protein YdaP
  KO
K00158  pyruvate oxidase [EC:1.2.3.3]
Organism
bsu  Bacillus subtilis subsp. subtilis 168
Pathway
bsu00620  Pyruvate metabolism
bsu01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:bsu00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00620 Pyruvate metabolism
    BSU04340 (ydaP)
Enzymes [BR:bsu01000]
 1. Oxidoreductases
  1.2  Acting on the aldehyde or oxo group of donors
   1.2.3  With oxygen as acceptor
    1.2.3.3  pyruvate oxidase
     BSU04340 (ydaP)
SSDB
Motif
Pfam: TPP_enzyme_N TPP_enzyme_C TPP_enzyme_M PAF-AH_p_II DXP_synthase_N CO_dh
Other DBs
NCBI-GeneID: 938239
NCBI-ProteinID: NP_388315
Pasteur: BG12063
BSORF: BG12063
UniProt: P96591 A0A6M4JFA5
LinkDB
Position
488830..490554
AA seq 574 aa
MAHKTAGQAMTELLEQWGVDHVYGIPGDSINEFIEELRHERNQLKFIQTRHEEVAALAAA
AEAKLTGKIGVCLSIAGPGAVHLLNGLYDAKADGAPVLAIAGQVSSGEVGRDYFQEIKLE
QMFEDVAVFNREVHSAESLPDLLNQAIRTAYSKKGVAVLSVSDDLFAEKIKREPVYTSPV
YIEGNLEPKKEQLVTCAQYINNAKKPIILAGQGMKKAKRELLEFADKAAAPIVVTLPAKG
VVPDKHPHFLGNLGQIGTKPAYEAMEECDLLIMLGTSFPYRDYLPDDTPAIQLDSDPAKI
GKRYPVTAGLVCDSALGLRELTEYIERKEDRRFLNACTEHMQHWWNEIEKDETEATTPLK
PQQVVARLQEAAADDAVLSVDVGTVTVWMARHFKMNANQDFIVSSWLATMGCGLPGAIAA
SLSEPERQAIAVCGDGGFSMVMQDLPTAVKYKLPITVVILNNENLGMIEYEQQVKGNIDY
VTKLQNVDYAAFAESCGAKGIKVTKAEELAPAFHEALHSDQPVVVDVMIGNEPPLPGKIT
YGQAKGFSKYMLKNFFENQKFEMPSLKKSLKRLF
NT seq 1725 nt   +upstreamnt  +downstreamnt
atggcacacaaaactgcaggacaagcaatgacagagctgcttgagcaatggggagttgat
catgtatacggcatccccggagacagtataaatgagtttatcgaagaattaagacacgaa
agaaatcaactgaagttcattcaaacccgccacgaagaggtagcggcactggcagccgcg
gctgaagcaaaactcaccggcaagatcggagtctgtctgtcaatcgcagggccgggagcg
gtgcacttattaaatggtttatatgatgctaaagccgacggcgcccctgtgctggcgatt
gcaggacaggtttcttctggcgaagtcggacgggactatttccaggagattaagctggag
caaatgtttgaggacgtggccgtgttcaacagagaggtacatagcgcggaatcacttccg
gatctcttaaatcaggcgatcaggaccgcctacagcaaaaaaggcgttgcggtattgagc
gtgtcagatgatttgtttgcggagaaaatcaaacgggagcccgtgtatacttcaccggtg
tatattgaagggaacctagaaccgaaaaaagaacagctcgtcacctgcgcccaatatatt
aataacgctaagaaaccgattatcctggcagggcagggaatgaaaaaggcgaaacgggag
ctcttagaatttgcggacaaagccgccgctccgatcgttgttacactcccggcaaagggt
gttgttcccgataagcacccacattttctcggcaacctcggtcagatcggaacaaagccg
gcttacgaggcaatggaggaatgtgatttattaatcatgctcggaacgtcattcccgtac
cgtgattatttgcctgatgacacgccggcgatacagctcgattcagacccggcaaaaatc
ggaaaacggtatccggtgacagcgggccttgtctgtgattcggctctcggtttgcgcgaa
ttgacagagtatattgaacgcaaggaagacagaagattcctgaatgcctgcacagaacat
atgcagcattggtggaacgaaattgaaaaagatgagacagaggcaacaacaccgcttaaa
cctcagcaggtcgtggcccgtcttcaggaagcggcagccgatgatgcggtgctctctgta
gatgtcggcactgtgacagtctggatggcgcgtcatttcaaaatgaacgcgaatcaggat
ttcatcgtttccagctggcttgcgacaatgggctgcggcctgccgggagcgattgcagcg
agcttgtccgaaccggaacgccaggcgatcgccgtctgcggtgacgggggattttccatg
gtcatgcaggaccttccgaccgccgttaaatataagctcccgatcacagtcgttatttta
aacaacgaaaatctcggcatgattgagtacgagcagcaggtcaaaggcaatatcgactat
gtcacaaaacttcaaaatgtcgactatgccgcatttgcagaaagctgcggagcaaagggc
atcaaagtgaccaaagcggaagagcttgcgccggcttttcatgaggcgctgcactctgac
caaccggtcgtagtggatgtcatgattggaaacgaaccgccgcttcctggcaaaatcacc
tacgggcaggcgaaaggctttagcaagtacatgctgaaaaacttcttcgaaaaccaaaaa
tttgaaatgccgtcactgaagaaaagtttgaaacggttattttaa

DBGET integrated database retrieval system