KEGG   Bacillus subtilis subsp. subtilis 168: BSU04450
Entry
BSU04450          CDS       T00010                                 

Symbol
dctS
Name
(RefSeq) C4-dicarboxylate sensor kinase
  KO
K11691  two-component system, CitB family, sensor histidine kinase DctS [EC:2.7.13.3]
Organism
bsu  Bacillus subtilis subsp. subtilis 168
Pathway
bsu02020  Two-component system
Brite
KEGG Orthology (KO) [BR:bsu00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   02020 Two-component system
    BSU04450 (dctS)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:bsu01001]
    BSU04450 (dctS)
  09183 Protein families: signaling and cellular processes
   02022 Two-component system [BR:bsu02022]
    BSU04450 (dctS)
Enzymes [BR:bsu01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.13  Protein-histidine kinases
    2.7.13.3  histidine kinase
     BSU04450 (dctS)
Protein kinases [BR:bsu01001]
 Histidine kinases
  CitB family [OT]
   BSU04450 (dctS)
Two-component system [BR:bsu02022]
 CitB family
  DctS-DctR (C4-dicarboxylate transport)
   BSU04450 (dctS)
SSDB
Motif
Pfam: sCache_3_2 HATPase_c HATPase_c_5 SPOB_a PAS_9 sCache_2 ArlS_N HATPase_c_2 PAS_8 PAS_10 PAS PAS_4 dCache_2 CsgF PAS_7
Other DBs
NCBI-GeneID: 938231
NCBI-ProteinID: NP_388326
Pasteur: BG12073
BSORF: BG12073
UniProt: P96601 A0A6M3Z7K0
LinkDB
Position
497768..499375
AA seq 535 aa
MNKKKLSIRWKITILSYILVIFSFLIGGIVLIGNIQHTEERELKKRLMNTARTVSEMTEV
KEALARKKQTEAVRHAVEEIRMINEADYIVVMDMNHIRYTHPVSTSIGKKSEGADEEAAF
AEHIYFSEAKGEIGTAVRAFYPVKDQDLNQIGVVLVGKTLPGIADILLHLKRDIAFIVVL
TLGFGLAGSFLLARHIKKQMFQLEPHEIVRMYEERTATFHSMNEGVIAIDNRLVITIFNE
KAKQIFEVQGDLIGKVIWEVLKDSRLPEIVERNKAVYNEEIRVSGKVIMSSRIPIVMKKK
VIGAVAIFQDRTEAAKMAEELTGVRNFVEALRVQNHEHMNKLHTIAGLIQLGKSEKALQL
AFQASTEQENVTEFLHRSIQNDAAAGLLLSKIRRGRELGIAVHIDENSSLQQFPEHVDQH
DIVVLLGNLIENAFGSFETVQSEDKRIDISIEQTDDILAILIEDNGCGIEPTHMPRLYDK
GFTVNKTGGTGYGLYLVKQIIDKGSGTIEVDSHAGQGTSFSIVFPMKGEEAQHGS
NT seq 1608 nt   +upstreamnt  +downstreamnt
atgaacaaaaagaagctctcaatccgttggaaaatcacgatcttatcctatatactcgtc
attttctcctttttgatcggcggcattgtgctcatcggcaacattcagcatacagaggag
cgggagctgaaaaagcggctgatgaatacggcccggacggtgtcagagatgacagaagtg
aaagaagccttggcgcgaaaaaaacaaacagaagcggttcgccatgcggttgaagaaatc
aggatgattaatgaagcagactatattgtcgtcatggatatgaatcacatccgatatacg
catcctgtcagcacaagcattggcaagaaatcagaaggtgcagacgaggaggcagctttt
gcggagcacatttatttctctgaagcaaagggcgagatcggcacggcggttcgcgctttt
tatccggtaaaggatcaagacctgaaccaaataggcgtggtgcttgtcggaaaaacgctg
ccggggatcgctgacatcctgcttcatttaaagcgtgatatcgccttcatcgttgtgctg
acactcggctttggccttgctggttcctttttgctggcccgccatatcaaaaaacaaatg
tttcagcttgaaccccatgagattgtccgaatgtatgaagaacggacagcgacgtttcac
tcgatgaatgaaggggtgatcgctattgacaatcgtctcgtcattacgatcttcaatgaa
aaagcgaaacagatctttgaagtgcagggggatctaatcggcaaggtgatttgggaggtt
ctcaaggattcgcgcctgcccgaaatcgtggagcggaacaaagcggtttataatgaagaa
attcgtgtcagcggtaaggtgatcatgagcagcagaattccgatcgtcatgaagaaaaaa
gtgatcggcgccgttgcgatttttcaggacagaacggaagcggccaagatggcagaggaa
ttgactggtgtcagaaactttgtggaggcgctccgtgtccaaaaccatgagcatatgaat
aagctgcacacgatcgccggtctcatccagctggggaaatctgaaaaagccttgcagctt
gcattccaggcgtcaactgagcaggaaaatgtgactgaatttctgcaccgctcgattcaa
aatgacgctgcggcaggccttctattaagtaaaatcagaaggggaagagagctcggcatt
gctgttcatatagatgaaaacagcagtcttcagcaatttcccgagcatgttgatcagcat
gatattgtcgtgcttttggggaatctgattgaaaatgccttcggctcatttgaaaccgtt
caatctgaagacaaacgaattgacattagtatcgaacaaacagatgatatccttgctatt
ttaatagaagataacggctgcggaattgaaccgacacatatgcctcgcctttatgacaaa
ggttttacggtcaataaaactggcggcacaggctatggcctgtatctagtgaaacaaatc
atagacaaaggatcgggcacgatagaagttgattcacatgcggggcaggggacatctttt
tctatcgtttttccaatgaagggggaggaagcacagcatggctcgtaa

DBGET integrated database retrieval system