KEGG   Bacillus subtilis subsp. subtilis 168: BSU04730
Entry
BSU04730          CDS       T00010                                 

Symbol
sigB
Name
(RefSeq) RNA polymerase sigma-B factor
  KO
K03090  RNA polymerase sigma-B factor
Organism
bsu  Bacillus subtilis subsp. subtilis 168
Brite
KEGG Orthology (KO) [BR:bsu00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03021 Transcription machinery [BR:bsu03021]
    BSU04730 (sigB)
Transcription machinery [BR:bsu03021]
 Prokaryotic type
  Bacterial type
   RNA polymerase
    Sigma factors
     BSU04730 (sigB)
SSDB
Motif
Pfam: Sigma70_r4 Sigma70_r3 Sigma70_r2 Sigma70_r4_2 HTH_23 DUF1492 GerE DUF134 Phage_rep_O HTH_16 KORA IF2_N DUF1292
Other DBs
NCBI-GeneID: 939937
NCBI-ProteinID: NP_388354
Pasteur: BG10735
BSORF: BG10735
UniProt: P06574 A0A6M4JFM2
LinkDB
Position
522862..523650
AA seq 262 aa
MTQPSKTTKLTKDEVDRLISDYQTKQDEQAQETLVRVYTNLVDMLAKKYSKGKSFHEDLR
QVGMIGLLGAIKRYDPVVGKSFEAFAIPTIIGEIKRFLRDKTWSVHVPRRIKELGPRIKM
AVDQLTTETQRSPKVEEIAEFLDVSEEEVLETMEMGKSYQALSVDHSIEADSDGSTVTIL
DIVGSQEDGYERVNQQLMLQSVLHVLSDREKQIIDLTYIQNKSQKETGDILGISQMHVSR
LQRKAVKKLREALIEDPSMELM
NT seq 789 nt   +upstreamnt  +downstreamnt
atgacacaaccatcaaaaactacgaaactaactaaagatgaagtcgatcggctcataagc
gattaccaaacaaagcaagatgaacaagcgcaggaaacgcttgtgcgggtgtatacaaat
ctggttgacatgcttgcgaaaaaatactcaaaaggcaaaagcttccacgaggatctccgc
caggtcggcatgatcgggctgctaggcgcgattaagcgatacgatcctgttgtcggcaaa
tcgtttgaagcttttgcaatcccgacaatcatcggtgaaattaaacgtttcctcagagat
aaaacatggagcgttcatgtgccgagacgaattaaagaactcggtccaagaatcaaaatg
gcggttgatcagctgaccactgaaacacaaagatcgccgaaagtcgaagagattgccgaa
ttcctcgatgtttctgaagaagaggttcttgaaacgatggaaatgggcaaaagctatcaa
gccttatccgttgaccacagcattgaagcggattcggacggaagcactgtcacgattctt
gatatcgtcggatcacaggaggacggatatgagcgggtcaaccagcaattgatgctgcaa
agcgtgcttcatgtcctttcagaccgtgagaaacaaatcatagaccttacgtatattcaa
aacaaaagccaaaaagaaactggggacattctcggtatatctcaaatgcacgtctcgcgc
ttgcaacgcaaagctgtgaagaagctcagagaggccttgattgaagatccctcgatggag
ttaatgtaa

DBGET integrated database retrieval system