KEGG   Bacillus subtilis subsp. subtilis 168: BSU05280
Entry
BSU05280          CDS       T00010                                 
Symbol
ydeO
Name
(RefSeq) hypothetical protein
Organism
bsu  Bacillus subtilis subsp. subtilis 168
SSDB
Motif
Pfam: YitT_membrane DUF2179
Other DBs
NCBI-GeneID: 938098
NCBI-ProteinID: NP_388409
Pasteur: BG12142
BSORF: BG12142
UniProt: P96672 A0A6M3ZD28
LinkDB
Position
574690..575562
AA seq 290 aa
MNTPKKHKKFKAKMILQIIMVIIGGIIAAYGLETVLIPNSVSDGGVTGLSIVGSQLFNLP
LGILIAVINIPFVWLGYKQIGKSFALLSIIGIVSLAAGTSFFHHTPAIIEGDTLLITVVG
GIILGFGMGLALRNGGALDGIDMLAVLLSRKLPFGTSDLILFLNLFVFIFVSTVFGLQGA
LLSVIAYYIASKVIHVVEEGLSGSKTFQIITTQPELMVETIRDQLGRSATYKEAYGGFSH
EKFKEITCVINRLEETKLKEIINDIDKTAFVTVYDVAEVKGSNFRNLNHH
NT seq 873 nt   +upstreamnt  +downstreamnt
atgaatacacccaaaaaacataagaaatttaaagcgaaaatgattctccaaatcatcatg
gttatcattggaggaatcatagcggcatatggactagaaacagtgctcattccaaacagt
gtatctgatggaggggtgacgggtcttagcatcgttggttcacagctattcaacttgccg
ctggggattttgattgctgtgatcaacattccatttgtctggttaggatataagcaaatt
gggaaaagctttgcattattatcaattatcggaatcgtatcgcttgccgcggggacaagc
tttttccaccacacacccgctatcatagaaggagataccctgttaattaccgttgtcggc
gggattatccttggattcggaatggggctggcgctgcgtaatggcggcgcattagatgga
attgacatgcttgctgtgctgctatcccgaaaactgccattcggaacgagcgatctcatt
ctattcttaaacctatttgtgtttatttttgtttccacagtatttggcttacaaggggca
ttgctttcagtcattgcttactacattgcatccaaagtgattcatgttgtggaggaaggc
ttaagcggctctaaaacctttcaaattattacaacccaacctgaattaatggtagagaca
atacgtgatcaattaggccgaagcgccacatataaagaagcttacgggggtttttcccac
gagaaatttaaagaaatcacatgtgtcatcaaccgtttagaagaaaccaaactaaaggaa
attattaatgatattgataaaactgcctttgttaccgtgtatgatgtagctgaagtgaag
ggcagcaattttagaaatcttaatcatcactaa

DBGET integrated database retrieval system