KEGG   Bacillus subtilis subsp. subtilis 168: BSU05610
Entry
BSU05610          CDS       T00010                                 
Symbol
vmlR
Name
(RefSeq) nucleotide-binding protein ExpZ
  KO
K18231  macrolide transport system ATP-binding/permease protein
Organism
bsu  Bacillus subtilis subsp. subtilis 168
Pathway
bsu02010  ABC transporters
Brite
KEGG Orthology (KO) [BR:bsu00001]
 09130 Environmental Information Processing
  09131 Membrane transport
   02010 ABC transporters
    BSU05610 (vmlR)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:bsu02000]
    BSU05610 (vmlR)
   01504 Antimicrobial resistance genes [BR:bsu01504]
    BSU05610 (vmlR)
Transporters [BR:bsu02000]
 ABC transporters, eukaryotic type
  Other subfamilies
   Macrolide exporter
    BSU05610 (vmlR)
Antimicrobial resistance genes [BR:bsu01504]
 Gene variants
  Macrolide resistance genes
   Transporters
    BSU05610 (vmlR)
SSDB
Motif
Pfam: ABC_tran AAA_21 SMC_N AAA_22 AAA_29 AAA_30 ABC_tran_Xtn RsgA_GTPase NB-ARC AAA_16 AAA_33 AAA_23 MMR_HSR1 AAA_18 NACHT AAA_28 ATP-synt_ab AAA_14 cobW AAA_24 TsaE Dynamin_N DO-GTPase2 KAP_NTPase Sigma54_activat T2SSE Zeta_toxin SRPRB AAA_7 MeaB AAA_15 ATPase_2 PRK Peptidase_M23
Other DBs
NCBI-GeneID: 938053
NCBI-ProteinID: NP_388442
Pasteur: BG10767
BSORF: BG10767
UniProt: P39115 A0A6M4JDR2
Structure
LinkDB
Position
complement(604736..606379)
AA seq 547 aa
MKEIVTLTNVSYEVKDQTVFKHVNASVQQGDIIGIIGKNGAGKSTLLHLIHNDLAPAQGQ
ILRKDIKLALVEQETAAYSFADQTPAEKKLLEKWHVPLRDFHQLSGGEKLKARLAKGLSE
DADLLLLDEPTNHLDEKSLQFLIQQLKHYNGTVILVSHDRYFLDEAATKIWSLEDQTLIE
FKGNYSGYMKFREKKRLTQQREYEKQQKMVERIEAQMNGLASWSEKAHAQSTKKEGFKEY
HRVKAKRTDAQIKSKQKRLEKELEKAKAEPVTPEYTVRFSIDTTHKTGKRFLEVQNVTKA
FGERTLFKNANFTIQHGEKVAIIGPNGSGKTTLLNIILGQETAEGSVWVSPSANIGYLTQ
EVFDLPLEQTPEELFENETFKARGHVQNLMRHLGFTAAQWTEPIKHMSMGERVKIKLMAY
ILEEKDVLILDEPTNHLDLPSREQLEETLSQYSGTLLAVSHDRYFLEKTTNSKLVISNNG
IEKQLNDVPSERNEREELRLKLETERQEVLGKLSFMTPNDKGYKELDQAFNELTKRIKEL
DHQDKKD
NT seq 1644 nt   +upstreamnt  +downstreamnt
atgaaagagatcgtaacattaacaaacgttagctatgaagtaaaggatcaaactgttttt
aaacatgtaaacgccagtgttcagcaaggagatatcattgggattatcggcaaaaacggc
gctgggaaatctacgttgctgcacctcattcacaatgacttagcccctgcacagggtcaa
atccttcggaaggatataaaactggctttggttgaacaggaaaccgcggcgtattccttt
gcggatcagacacctgccgaaaagaagttactggagaaatggcatgtgcctcttcgtgat
tttcatcagttaagcggcggtgaaaaactgaaagcgcggctggcgaaaggactatcagag
gatgcagatctgctgctgttagatgaaccgacaaaccaccttgatgaaaaaagcttgcaa
tttctcatccaacagctgaaacattataacggcactgtgattctcgtttctcacgatcga
tattttttagacgaagccgcaacaaaaatatggtcgcttgaggatcagacgctgattgaa
ttcaaagggaattactccgggtatatgaagttccgggagaagaaaagactcacccagcag
cgtgaatatgaaaagcagcaaaaaatggttgaacggattgaagcacaaatgaatgggctc
gcttcttggtcggaaaaagcccatgctcaatcgacgaaaaaggaagggtttaaagaatat
caccgggtaaaagcgaagcgtacggatgcccagataaaatccaagcagaagcggcttgaa
aaagagcttgaaaaagcaaaggcggaacccgttaccccagaatatacagtccgcttttca
atcgatacaacccacaaaacaggaaaacgttttttagaagttcagaatgtaacaaaagcg
tttggagaaaggactctctttaaaaacgcaaactttacaattcagcacggcgaaaaggtt
gcgatcataggccccaatggcagcggaaaaacgacattactgaacatcattctgggacag
gaaacagcagaaggaagtgtatgggtgtcgccgtccgcaaacatcggctatttaacgcag
gaggtgtttgatttgcctttagaacaaacaccggaagagttatttgagaatgaaacattc
aaagcaagggggcacgttcaaaatctgatgaggcacttaggttttacagccgcccaatgg
actgaaccgatcaagcatatgagtatgggtgagcgtgtaaagatcaagctgatggcatat
attctggaggaaaaagacgtgctgattttagatgagccgacaaaccatctcgacctgccg
tcacgcgaacagctggaagaaacactgtcacaatacagcggcacattgctggcggtttca
catgaccgatactttctcgaaaaaacaacaaacagtaaactcgtcatctcaaacaacggc
atcgaaaagcagttaaacgacgttccttcagaaagaaatgagcgggaggagcttcggtta
aagcttgagacagaaagacaagaagtgctgggaaagctcagttttatgacgccaaatgat
aaagggtataaggagcttgatcaggctttcaatgagcttacgaaacgaataaaagagctg
gatcatcaagacaaaaaagactga

DBGET integrated database retrieval system