KEGG   Bacillus subtilis subsp. subtilis 168: BSU06310Help
Entry
BSU06310          CDS       T00010                                 

Gene name
gabP
Definition
(RefSeq) GABA permease
  KO
K11735  GABA permease
Organism
bsu  Bacillus subtilis subsp. subtilis 168
Brite
KEGG Orthology (KO) [BR:bsu00001]
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:bsu02000]
    BSU06310 (gabP)
Transporters [BR:bsu02000]
 Other transporters
  Electrochemical potential-driven transporters [TC:2]
   BSU06310 (gabP)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: AA_permease AA_permease_2 Spore_permease Glycophorin_A
Motif
Other DBs
NCBI-GeneID: 939485
NCBI-ProteinID: NP_388512
Pasteur: BG11328
BSORF: BG11328
UniProt: P46349
LinkDB All DBs
Position
complement(685155..686564)
Genome map
AA seq 469 aa AA seqDB search
MNQSQSGLKKELKTRHMTMISIAGVIGAGLFVGSGSVIHSTGPGAVVSYALAGLLVIFIM
RMLGEMSAVNPTSGSFSQYAHDAIGPWAGFTIGWLYWFFWVIVIAIEAIAGAGIIQYWFH
DIPLWLTSLILTIVLTLTNVYSVKSFGEFEYWFSLIKVVTIIAFLIVGFAFIFGFAPGSE
PVGFSNLTGKGGFFPEGISSVLLGIVVVIFSFMGTEIVAIAAGETSNPIESVTKATRSVV
WRIIVFYVGSIAIVVALLPWNSANILESPFVAVLEHIGVPAAAQIMNFIVLTAVLSCLNS
GLYTTSRMLYSLAERNEAPRRFMKLSKKGVPVQAIVAGTFFSYIAVVMNYFSPDTVFLFL
VNSSGAIALLVYLVIAVSQLKMRKKLEKTNPEALKIKMWLFPFLTYLTIIAICGILVSMA
FIDSMRDELLLTGVITGIVLISYLVFRKRKVSEKAAANPVTQQQPDILP
NT seq 1410 nt NT seq  +upstreamnt  +downstreamnt
atgaaccagtctcaatcaggattaaaaaaggaattaaagacccgccatatgacaatgatt
tcgattgccggtgtaatcggagccggcctatttgtaggcagcggttcagtgattcactcg
accggtccgggtgccgttgtttcttacgcgttagccggattattggtgatttttattatg
agaatgctcggtgagatgtctgccgtaaacccgacgagcggatcgttttctcaatacgct
cacgacgccatcggaccgtgggcaggatttacaatcggctggctgtactggtttttctgg
gtgatcgtcatagcgatcgaagccattgccggtgctggcattattcaatactggttccat
gatattccgctgtggctgacaagtttgatcttgaccattgtgctcaccctgacaaacgtc
tactccgttaagtctttcggtgagtttgaatattggttctccctcattaaagttgtgact
atcattgcttttctaatcgttggttttgcctttatttttggctttgcaccgggcagtgag
ccagtcggtttttcgaatcttacaggcaaaggcggatttttcccggagggcatcagctcc
gtattgctcggcattgtcgttgtcatcttctcttttatgggaactgaaatcgttgccatt
gcagcaggggaaacatccaacccgatcgaatctgtgacaaaagccaccagatccgttgta
tggcgcatcatcgtcttttacgtgggctcaatcgccattgtcgtggcgctgttgccatgg
aattcagcaaatattttagaaagccctttcgtcgctgtacttgagcatataggagtgccc
gcagccgcacagattatgaactttatcgtcctcacagccgtactctcttgcctgaattca
ggtttgtataccacatccagaatgctgtattcacttgcagaaagaaatgaagcgccgcgc
cgttttatgaaattgagcaaaaaaggcgttcccgtacaagccattgtggccgggacattt
ttctcttatatcgcggtcgtaatgaactatttttcaccggataccgtctttttattctta
gtcaactcatcaggcgcaatcgctttactcgtctatcttgtcatcgccgtttcccagctg
aaaatgcggaaaaaactcgaaaaaacaaacccagaagcattgaagatcaaaatgtggctc
ttccctttcctaacctacttgaccatcatcgccatttgcggaattttagtgtccatggcg
tttattgattccatgagagacgagctgctgctgacaggcgtcatcacgggaatcgttctg
atttcttaccttgtgttcagaaaacgcaaggtgagcgagaaagcggctgccaacccagtc
acacagcagcaacccgatatcctgccttaa

DBGET integrated database retrieval system