KEGG   Bacillus subtilis subsp. subtilis 168: BSU06510
Entry
BSU06510          CDS       T00010                                 

Gene name
purN
Definition
(RefSeq) phosphoribosylglycinamide formyltransferase
  KO
K11175  phosphoribosylglycinamide formyltransferase 1 [EC:2.1.2.2]
Organism
bsu  Bacillus subtilis subsp. subtilis 168
Pathway
bsu00230  Purine metabolism
bsu00670  One carbon pool by folate
bsu01100  Metabolic pathways
bsu01110  Biosynthesis of secondary metabolites
Module
bsu_M00048  Inosine monophosphate biosynthesis, PRPP + glutamine => IMP
Brite
KEGG Orthology (KO) [BR:bsu00001]
 09100 Metabolism
  09104 Nucleotide metabolism
   00230 Purine metabolism
    BSU06510 (purN)
  09108 Metabolism of cofactors and vitamins
   00670 One carbon pool by folate
    BSU06510 (purN)
Enzymes [BR:bsu01000]
 2. Transferases
  2.1  Transferring one-carbon groups
   2.1.2  Hydroxymethyl-, formyl- and related transferases
    2.1.2.2  phosphoribosylglycinamide formyltransferase 1
     BSU06510 (purN)
SSDB
Motif
Pfam: Formyl_trans_N
Other DBs
NCBI-GeneID: 936045
NCBI-ProteinID: NP_388533
Pasteur: BG10709
BSORF: BG10709
UniProt: P12040 A0A6M4JDZ6
LinkDB
Position
708010..708597
AA seq 195 aa
MKKFAVFASGNGSNFEAIVTRLKEENWDASAALLVCDKPQAKVIERAEAFHIPSFAFEPK
SYENKAAFEQAIIEQLRLHEVELIALAGYMRLIGDTLLQAYGGKIINIHPSLLPAFPGID
AVGQAFRAGVKVAGITVHYVDEGMDTGPIIAQKAIEIDEHDTLETIEQRIHKLEHKWYPS
VIKQLLGLNNRGEKA
NT seq 588 nt   +upstreamnt  +downstreamnt
atgaaaaagtttgcggtatttgcatcaggaaacggttcaaacttcgaagccatcgtcacg
cgtttgaaggaggagaactgggatgcgtcagcagcgctcctcgtttgcgacaaaccgcag
gcgaaagtcatcgaacgggcggaagcattccacattccatccttcgcatttgagccgaag
tcttatgaaaacaaggctgcatttgaacaagccatcattgaacagcttcgtcttcacgag
gttgaattgattgctcttgccggctatatgaggctgatcggtgatacgctccttcaagca
tatgggggaaaaatcattaacattcacccatcgcttcttccggcgtttcctggaatcgac
gcagtcggacaggcgttccgggcgggtgtgaaggtggccggaatcaccgtgcattatgtc
gatgaaggaatggatacaggtccgatcatcgctcaaaaggcaatcgaaattgatgaacat
gatacattggaaacaatcgaacagcgaattcacaagcttgagcataaatggtatccgagt
gtgattaaacagctattaggattaaataacagaggtgaaaaggcatga

DBGET integrated database retrieval system