KEGG   Bacillus subtilis subsp. subtilis 168: BSU06540
Entry
BSU06540          CDS       T00010                                 
Symbol
yezC
Name
(RefSeq) AsnC family transcriptional regulator
Organism
bsu  Bacillus subtilis subsp. subtilis 168
SSDB
Motif
Pfam: HTH_24 HTH_AsnC-type AsnC_trans_reg MarR_2 MarR HTH_20 TrmB LexA_DNA_bind HTH_39 HTH_Crp_2 HTH_27 HTH_IclR Xre-like-HTH
Other DBs
NCBI-GeneID: 936047
NCBI-ProteinID: NP_388536
Pasteur: BG12874
UniProt: O31497 A0A6M3ZBD2
LinkDB
Position
complement(711456..711875)
AA seq 139 aa
MDDTDLQILSHLQRNGRLTMVELGKLVGLSSPSAAERVRKLEDKGVITGYSANICYEKLN
KHVTAFILMEPKSCKHYAAFATSHPDVAENHRITGMYSYVTKVVTESVHTLEDFIDTSMA
HGKPTTLVVLSSSSCHPAF
NT seq 420 nt   +upstreamnt  +downstreamnt
atggacgatacagaccttcagattctctcgcatttgcagcgaaacggcagattaacgatg
gttgagctgggaaagcttgtcggactcagctcgccaagcgcggcggagcgtgtcaggaag
ctggaagacaaaggagtgattaccggctacagcgcgaatatctgttacgaaaaactaaac
aagcatgtcaccgcttttattctcatggagccgaaaagctgcaagcactacgccgccttt
gcaacatcgcatcctgatgtagcagaaaaccaccgcatcacggggatgtacagctatgtg
acaaaggtcgtgactgaatcggtacatacgcttgaggattttattgacacctcgatggcc
catggaaaaccaaccacgctcgttgtgctttcttcttctagctgccatcccgctttttga

DBGET integrated database retrieval system