KEGG   Bacillus subtilis subsp. subtilis 168: BSU06680Help
Entry
BSU06680          CDS       T00010                                 

Gene name
gatA
Definition
(RefSeq) glutamyl-tRNA(Gln) amidotransferase subunit A
  KO
K02433  aspartyl-tRNA(Asn)/glutamyl-tRNA(Gln) amidotransferase subunit A [EC:6.3.5.6 6.3.5.7]
Organism
bsu  Bacillus subtilis subsp. subtilis 168
Pathway
bsu00970  Aminoacyl-tRNA biosynthesis
bsu01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:bsu00001]
 09120 Genetic Information Processing
  09122 Translation
   00970 Aminoacyl-tRNA biosynthesis
    BSU06680 (gatA)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03029 Mitochondrial biogenesis [BR:bsu03029]
    BSU06680 (gatA)
Enzymes [BR:bsu01000]
 6. Ligases
  6.3  Forming carbon-nitrogen bonds
   6.3.5  Carbon-nitrogen ligases with glutamine as amido-N-donor
    6.3.5.6  asparaginyl-tRNA synthase (glutamine-hydrolysing)
     BSU06680 (gatA)
    6.3.5.7  glutaminyl-tRNA synthase (glutamine-hydrolysing)
     BSU06680 (gatA)
Mitochondrial biogenesis [BR:bsu03029]
 Mitochondrial DNA transcription, translation, and replication factors
  Mitochondrial transcription and translation factors
   Other mitochondrial DNA transcription and translation factors
    BSU06680 (gatA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Amidase
Motif
Other DBs
NCBI-GeneID: 938748
NCBI-ProteinID: NP_388550
Pasteur: BG12839
BSORF: BG12839
UniProt: O06491
LinkDB All DBs
Position
729038..730495
Genome map
AA seq 485 aa AA seqDB search
MSLFDHKITELKQLIHKKEIKISDLVDESYKRIQAVDDKVQAFLALDEERARAYAKELDE
AVDGRSEHGLLFGMPIGVKDNIVTKGLRTTCSSKILENFDPIYDATVVQRLQDAEAVTIG
KLNMDEFAMGSSTENSAYKLTKNPWNLDTVPGGSSGGSAAAVAAGEVPFSLGSDTGGSIR
QPASFCGVVGLKPTYGRVSRYGLVAFASSLDQIGPITRTVEDNAFLLQAISGVDKMDSTS
ANVDVPDFLSSLTGDIKGLKIAVPKEYLGEGVGKEARESVLAALKVLEGLGATWEEVSLP
HSKYALATYYLLSSSEASANLARFDGIRYGYRTDNADNLIDLYKQTRAEGFGNEVKRRIM
LGTFALSSGYYDAYYKKAQKVRTLIKKDFEDVFEKYDVIVGPTTPTPAFKIGENTKDPLT
MYANDILTIPVNLAGVPGISVPCGLADGLPLGLQIIGKHFDESTVYRVAHAFEQATDHHK
AKPEL
NT seq 1458 nt NT seq  +upstreamnt  +downstreamnt
atgtcattatttgatcataaaatcacagaattaaaacagctcatacataaaaaagagatt
aagatttctgatctggttgatgaatcttataaacgcatccaagcggttgatgataaggta
caagcctttttggcattagatgaagaaagagcgcgcgcatacgcgaaggagcttgatgag
gcggttgacggccgttctgagcacggtcttcttttcggtatgccgatcggcgtaaaagat
aatatcgtaacaaaagggctgcgcacaacatgctccagcaaaattctcgaaaactttgat
ccgatttacgatgctactgtcgttcagcgccttcaagacgctgaagcggtcacaatcgga
aaactgaacatggacgaattcgccatggggtcatctacagaaaactcagcttacaagctg
acgaaaaacccttggaacctggatacagttcccggcggttcaagcggcggatctgcagct
gcggttgctgcgggagaagttccgttttctcttggatctgacacaggcggctccatccgt
cagccggcatctttctgcggcgttgtcggattaaaacctacatacggacgtgtatctcgt
tacggcctggtcgcatttgcgtcttcattggaccaaatcggaccgattacacgtacggtt
gaggataacgcgtttttacttcaagcgatttccggcgtagacaaaatggactctacgagt
gcaaatgtggacgtgcctgattttctttcttcattaactggcgacatcaaaggactgaaa
atcgccgttccgaaagaataccttggtgaaggtgtcggcaaagaagcgagagaatctgtc
ttggcagcgctgaaagtccttgaaggtctcggcgctacatgggaagaagtgtctcttccg
cacagtaaatacgcgcttgcgacatattacctgctgtcatcttctgaagcgtcagcgaac
cttgcacgctttgacggcatccgctacggctaccgcacagacaacgcggataacctgatc
gacctttacaagcaaacgcgcgctgaaggtttcggaaatgaagtcaaacgccgcatcatg
ctcggaacgtttgctttaagctcaggctactacgatgcgtactacaaaaaagcgcaaaaa
gtgcgtacgttgattaagaaggatttcgaggacgtatttgaaaaatatgatgttattgtt
ggaccgactacaccgacacctgcgtttaaaatcggtgaaaacacgaaggatccgctcaca
atgtacgcaaacgatatcttaacgattccggtcaaccttgccggcgtaccgggaatcagt
gtgccatgcggattagcagacggacttccgctcggcctgcaaatcatcggaaaacacttt
gatgaaagcactgtataccgcgttgctcatgcatttgaacaagcaacagaccatcataaa
gcaaaacctgaactgtaa

DBGET integrated database retrieval system