KEGG   Bacillus subtilis subsp. subtilis 168: BSU07370
Entry
BSU07370          CDS       T00010                                 
Symbol
yfmR
Name
(RefSeq) ABC transporter ATP-binding protein
  KO
K15738  ABC transport system ATP-binding/permease protein
Organism
bsu  Bacillus subtilis subsp. subtilis 168
Brite
KEGG Orthology (KO) [BR:bsu00001]
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:bsu02000]
    BSU07370 (yfmR)
Transporters [BR:bsu02000]
 ABC transporters, eukaryotic type
  Other subfamilies
   Other ABC transporters
    BSU07370 (yfmR)
SSDB
Motif
Pfam: ABC_tran AAA_21 ABC_tran_CTD ABC_tran_Xtn SMC_N RsgA_GTPase AAA_29 AAA_22 MMR_HSR1 AAA AAA_30 AAA_16 AAA_18 AAA_14 AAA_24 AAA_33 AAA_13 NACHT MeaB IstB_IS21 Roc Dynamin_N ATP-synt_ab AAA_23 PhoH AAA_28 AAA_15 Hen1_Lam_C SRP54 DO-GTPase2
Other DBs
NCBI-GeneID: 936100
NCBI-ProteinID: NP_388618
Pasteur: BG12969
BSORF: BG12969
UniProt: O06476 A0A6M3Z8Q6
LinkDB
Position
809557..811446
AA seq 629 aa
MSILKAENLYKTYGDKTLFDHISFHIEENERIGLIGPNGTGKSTLLKVIAGLESIEEGEI
TKSGSVQVEFLHQDPELPAGQTVLEHIYSGESAVMKTLREYEKALYELGKDPENEQRQKH
LLAAQAKMDANNAWDANTLAKTVLSKLGVNDVTKPVNELSGGQKKRVAIAKNLIQPADLL
ILDEPTNHLDNETIEWLEGYLSQYPGAVMLVTHDRYFLNRVTNRIYELERGSLYTYKGNY
EVFLEKRAEREAQAEQKETKRQNLLRRELAWLRRGAKARSTKQKARIDRVETLKEQTGPQ
SSGSLDFAIGSHRLGKQVIEAENVMIAYDGRMLVDRFNELVIPGERIGIIGPNGIGKTTL
LNALAGRHTPDGGDITIGQTVRIGYYTQDHSEMNGELKVIDYIKETAEVVKTADGDMITA
EQMLERFLFPRSMQQTYIRKLSGGEKRRLYLLQVLMQEPNVLFLDEPTNDLDTETLSVLE
DYIDQFPGVVITVSHDRYFLDRVVDRLIVFEGNGVISRFQGSYSDYMEESKAKKAAPKPA
AEEKTAEAEPKKKRKKLSYKDQLEWDGIEDKIAQLEEKHEQLEADIAAAGSDFGKIQELM
AEQAKTAEELEAAMDRWTELSLMIEELES
NT seq 1890 nt   +upstreamnt  +downstreamnt
atgagcatattaaaagcggaaaatctttataaaacatacggagataaaacattatttgac
catatctcctttcatattgaagagaatgagagaatcggattaatcgggccgaacggaaca
ggaaaatcaacgctgttgaaagtgattgccggcttggaatctatcgaagaaggagaaatc
acgaaatccggaagcgtgcaggtcgaatttcttcatcaagacccggagctgcctgcgggg
caaacagtgctggagcatatctattccggtgaatcggctgtgatgaaaaccttgcgtgaa
tatgaaaaagcgctgtatgaactggggaaagatcccgaaaatgaacagcgccagaaacac
ctgctggcagcacaagcgaaaatggacgcgaacaatgcatgggatgcaaacaccttggca
aaaaccgtattgtctaagctgggcgtcaacgacgtaacaaaaccggtcaatgagctctca
ggcggccagaaaaaacgggtggccattgccaaaaacttaattcagcccgctgatttgctc
attttggacgagccgacaaaccatttggataatgaaacgattgagtggcttgaagggtat
ttaagccaatatcccggcgccgtcatgctggtgacgcacgatagatatttcttaaaccgt
gtcaccaaccgcatttatgagcttgaaagaggcagcctctacacttacaaaggcaactat
gaagtgtttttagaaaaacgcgcggaacgggaagcgcaggctgagcaaaaggaaacgaag
cggcaaaacctgctgcgccgcgaactggcttggctcagacgaggagcgaaagcccgctcc
acaaaacaaaaagcgagaattgaccgggtagagacgcttaaagagcagacaggccctcag
tcatcaggttcactcgattttgccattggctcgcaccgtctcggaaaacaggttattgaa
gcggagaacgtcatgatcgcttatgacggccgcatgctcgtcgaccgttttaatgaactt
gtcataccaggtgaacggatcgggatcatcgggccgaacggcatcgggaaaacaacgctg
ttaaatgcccttgccggccgtcatacgccggacggaggcgatattacgatcggacagacg
gtcagaatcggctactatactcaggatcatagtgaaatgaacggtgagttaaaagtcatt
gactatataaaagaaacggcggaggtcgtaaaaacggcagatggcgatatgattacagct
gaacaaatgctcgagcgtttcctcttcccgcgttcgatgcagcagacgtatatccgcaag
ctgtccggcggggaaaaacgccgtttatacttgcttcaggttctcatgcaggagccgaat
gtcctgtttctcgatgagccgacgaacgatttggatactgaaacattaagcgttcttgag
gattatattgaccagttcccaggcgtcgtcatcaccgtatcccatgaccgctatttcctt
gaccgcgtcgtcgaccgtttgattgtatttgaaggaaatggtgtcatttcccgctttcaa
ggctcctatagcgactatatggaggagtcaaaagcgaaaaaagcggccccaaaaccggca
gctgaggaaaaaacggctgaagccgagccgaagaaaaaacggaaaaagctttcttacaaa
gaccagttggaatgggacggcatcgaagataaaattgcccagctggaagaaaagcatgaa
cagcttgaagctgacatcgccgcagcaggcagtgattttggcaaaatccaagagctgatg
gccgagcaggcgaaaacggcggaagagcttgaggctgcgatggaccgctggacagaattg
tccctcatgatcgaagaactggaaagctaa

DBGET integrated database retrieval system