KEGG   Bacillus subtilis subsp. subtilis 168: BSU07510
Entry
BSU07510          CDS       T00010                                 

Symbol
yfmD
Name
(RefSeq) Fe(3+)-citrate import system permease protein YfmD
  KO
K23183  ferric citrate transport system permease protein
Organism
bsu  Bacillus subtilis subsp. subtilis 168
Pathway
bsu02010  ABC transporters
Brite
KEGG Orthology (KO) [BR:bsu00001]
 09130 Environmental Information Processing
  09131 Membrane transport
   02010 ABC transporters
    BSU07510 (yfmD)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:bsu02000]
    BSU07510 (yfmD)
Transporters [BR:bsu02000]
 ABC transporters, prokaryotic type
  Metallic cation, iron-siderophore and vitamin B12 transporters
   Ferric citrate transporter
    BSU07510 (yfmD)
SSDB
Motif
Pfam: FecCD DUF6749
Other DBs
NCBI-GeneID: 936110
NCBI-ProteinID: NP_388632
Pasteur: BG12955
BSORF: BG12955
UniProt: O34933 A0A6M3Z8Z5
LinkDB
Position
complement(824714..825715)
AA seq 333 aa
MYHSAKRRSSSRLMMFIIALIIFIFGLGLNLSVGASDISIIDSLKYLFVWDGSKEQLIIS
TLRLPRTLIGVFVGASLAVAGALMQAMTRNPLASPQIFGVNAGASLFVVASLVILPASPY
SSVIFAFAGAAAGGAIVYMIASSGGMTPVKLALSGMAVHLFLSSMTQAIIILNESGEDVL
YWMTGAIDGSNWQDVITIAPFSVIGIGLALVFSGSVSVLGLGDETAKGLGQNMNGIRILI
SLIILILSGASVAVAGPIGFVGLLVPHIVRKLIGEHYQYVLPFSALFGAILLVYADVLAR
WIAFPYESPVGIVTAIIGTPFFLYLARKGRNLK
NT seq 1002 nt   +upstreamnt  +downstreamnt
ttgtatcattcagccaaacggcgctcatcatcaagactgatgatgtttatcattgcactg
attatttttatatttgggcttgggctgaatctttcagtaggagcctcagacatcagcatc
atagattcattgaaatatctttttgtatgggacggttcaaaggaacagctcatcatctct
actcttcgccttccccgcacattaatcggcgtttttgtcggcgccagcctagctgtagca
ggggcgctgatgcaggctatgaccagaaatcctctggcttcaccccaaattttcggtgtg
aatgcgggtgcatcgctttttgttgttgcttctctcgtcattctgccggcatcgccctat
tcatctgttatattcgcttttgcgggtgcggcagcaggcggcgcgattgtgtatatgatt
gcctcatccggcggaatgacgcctgtcaagctggcgctgtcaggaatggccgtgcacttg
ttcctctcctctatgacacaggccatcattattttaaatgagtcaggtgaggatgttctg
tactggatgacaggcgcaatcgacggcagcaactggcaggacgtcataaccatcgctcct
ttttctgtcattggcatcgggcttgccctcgtattttccggttctgtttctgttctcggt
ctcggagacgaaacagcaaaagggcttggacaaaatatgaacggcatcaggattctgatc
agtttgattattttaattctttccggcgcttccgtagccgtcgccgggccgattggcttt
gtcgggctgctcgtcccgcatattgtccgcaagctgatcggagaacattatcaatacgtg
cttccgttttcggcactgttcggtgccattttgctggtgtacgcagatgttctggccaga
tggattgcatttccttatgaatcaccggtcggcattgtcaccgcgattatcggaacgccg
tttttcttatatttggcaaggaaagggcgaaacctgaaatga

DBGET integrated database retrieval system