KEGG   Bacillus subtilis subsp. subtilis 168: BSU07590
Entry
BSU07590          CDS       T00010                                 

Symbol
citT
Name
(RefSeq) transcriptional regulatory protein CitT
  KO
K11638  two-component system, CitB family, response regulator CitT
Organism
bsu  Bacillus subtilis subsp. subtilis 168
Pathway
bsu02020  Two-component system
Brite
KEGG Orthology (KO) [BR:bsu00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   02020 Two-component system
    BSU07590 (citT)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02022 Two-component system [BR:bsu02022]
    BSU07590 (citT)
Two-component system [BR:bsu02022]
 CitB family
  CitS-CitT (magnesium-citrate transport)
   BSU07590 (citT)
SSDB
Motif
Pfam: Response_reg CitT HTH_11 HTH_micro Sigma70_r4 HTH_IclR HTH_23 HTH_3 MarR_2
Other DBs
NCBI-GeneID: 938806
NCBI-ProteinID: NP_388640
Pasteur: BG12577
BSORF: BG12577
UniProt: O34534 A0A6M4JDZ5
LinkDB
Position
832545..833225
AA seq 226 aa
MIHIAIAEDDFRVAQIHERLIKQLDGFKIIGKAANAKETLALLKEHKADLLLLDIYMPDE
LGTALIPDIRSRFPEVDIMIITAATETRHLQEALRAGIAHYLIKPVTADKFRQVLLQYKE
KRKLLMSQPEVSQSMIDHIFGNGVKTALPAEDLPTGINSITLRKIKEALQTASEGLTAEE
LGEKMGASRTTARRYAEYLVSKEEARAELEYGIIGRPERKYYLAAD
NT seq 681 nt   +upstreamnt  +downstreamnt
ttgattcacatcgcgattgcggaggatgattttcgagttgcgcaaatccatgagagattg
attaaacagcttgatggattcaagattatcggcaaggcggctaacgcaaaagagacattg
gcgcttttgaaggaacacaaggctgatttgcttctgctggatatttatatgccggacgag
cttgggaccgcgttgattcctgatatacgaagccgatttcctgaagtggacattatgatt
atcacagcggcaacagaaacccgtcatttgcaggaagcgctaagggcgggaattgcccac
tatttgatcaaacccgtaacagctgacaagttcaggcaggtgctgcttcagtataaagaa
aaaaggaagctgctcatgtctcagccggaggtcagccaatccatgatcgaccatattttt
gggaacggtgtgaagacagctttgccggcagaggatttgccgactggcattaattcgatt
acactgcgaaaaattaaggaagcgcttcagactgcgtcagaaggattgacagcggaggaa
cttggggaaaaaatgggggcgtcacgaacaactgcccgccgttatgccgagtaccttgtg
tcaaaggaagaagcaagagccgagcttgaatacgggattatcggcaggccggagagaaaa
tattatttggcggcggattag

DBGET integrated database retrieval system