KEGG   Bacillus subtilis subsp. subtilis 168: BSU07690
Entry
BSU07690          CDS       T00010                                 

Symbol
yflG
Name
(RefSeq) methionine aminopeptidase 2
  KO
K01265  methionyl aminopeptidase [EC:3.4.11.18]
Organism
bsu  Bacillus subtilis subsp. subtilis 168
Brite
KEGG Orthology (KO) [BR:bsu00001]
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01002 Peptidases and inhibitors [BR:bsu01002]
    BSU07690 (yflG)
Enzymes [BR:bsu01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.11  Aminopeptidases
    3.4.11.18  methionyl aminopeptidase
     BSU07690 (yflG)
Peptidases and inhibitors [BR:bsu01002]
 Metallo peptidases
  Family M24
   BSU07690 (yflG)
SSDB
Motif
Pfam: Peptidase_M24
Other DBs
NCBI-GeneID: 936121
NCBI-ProteinID: NP_388650
Pasteur: BG12942
BSORF: BG12942
UniProt: O34484 A0A6M3Z8G2
LinkDB
Position
complement(839735..840484)
AA seq 249 aa
MIVTNDQELEGLKKIGRIVALAREEMKRKAEPGMSTKDLDLIGKAVLDEHGAVSAPEKEY
DFPGVTCISVNDEVAHGIPSTSKILKAGDLVNIDISAEFGGFYSDTGISFVLGEGEERLH
KLCQCAENAFQKGLQQAKAGKRQNQIGRAVYHEARSQGFTVIKTLTGHGIGRSLHEAPNH
IMNYYDPFDNALFKNGTVIALEPFISTKAETIVEAGDGWTFKTPDKSMVAQVEHTIVITK
DEPIILTKL
NT seq 750 nt   +upstreamnt  +downstreamnt
atgattgtaacaaacgatcaagaattagaaggcctgaaaaaaatcggaagaatcgtcgcg
cttgcgcgtgaagaaatgaagcggaaggcagagcccggcatgagcacaaaagaccttgac
cttatcggaaaagctgtgcttgatgagcacggcgccgtttcagctcctgagaaggaatac
gattttccaggtgtgacatgtatcagcgtaaatgatgaagtggctcacggcataccaagc
acatccaaaattttaaaagcaggggaccttgtcaacatcgacatctccgctgaatttggc
ggcttctattccgacacaggcatctcatttgtgctcggtgaaggagaagaacgccttcat
aagctttgccaatgcgcggaaaacgcttttcaaaaggggcttcagcaggcaaaagcgggc
aagcgccaaaaccagatcggaagagccgtttatcatgaagcacgctctcaaggctttacc
gtcatcaaaaccctgaccggccacggaatcggccgaagcctgcatgaagcgccgaaccac
atcatgaactattatgatccgtttgataatgcgctgttcaaaaatggcacagtcatcgcg
cttgaaccgtttatttcaacgaaagcagaaacgattgttgaagctggagacggctggacg
ttcaagacgccggataaaagcatggttgcccaagttgaacacacgatcgtcatcacaaaa
gatgaaccgattatcctgacgaaactgtaa

DBGET integrated database retrieval system