KEGG   Bacillus subtilis subsp. subtilis 168: BSU07760Help
Entry
BSU07760          CDS       T00010                                 

Gene name
yfkT
Definition
(RefSeq) spore germination protein YfkT
  KO
K06309  spore germination protein
Organism
bsu  Bacillus subtilis subsp. subtilis 168
Brite
KEGG Orthology (KO) [BR:bsu00001]
 09190 Not Included in Pathway or Brite
  09193 Unclassified: signaling and cellular processes
   99978 Cell growth
    BSU07760 (yfkT)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Spore_permease
Motif
Other DBs
NCBI-GeneID: 936135
NCBI-ProteinID: NP_388657
Pasteur: BG12935
BSORF: BG12935
UniProt: O34573
LinkDB All DBs
Position
complement(846182..847258)
Genome map
AA seq 358 aa AA seqDB search
MDKTSAYQGLFFGALYTLAVGLKHAPILMIESAKQNAWHSYILGVVIVIPALWLMHRLMK
KHQDKNIYELLSDSSPIAGRIIILLFSLYFLLINAHDIRFFINLINILFLPRTPMAVLGG
VIIFVAICIAREGKETLTRMAQIFLFPFGILVLFLPFTLATQIELQNLTPVFEGLIPYLQ
SGYYAFGTMGELIILPLLFSNRSVPLKYTIFAILLGALLLAVMLFSSISVFGPNLTSTFF
DPAYMVIRQIRITDFLDRSDLIIAAFWIPVIMVKIAGSLYIVVYGLSFLHSKIDPKAMYT
PTGMFSVVCGFWFFLNTNQLIDFNRIKPIINVVISLLLPLLIYLIIKSKALFGAKAKH
NT seq 1077 nt NT seq  +upstreamnt  +downstreamnt
atggacaagacctctgcataccaaggattatttttcggagctctgtatacgttagcagtc
ggattaaagcatgctccgattctcatgatcgaatcagcaaaacaaaatgcctggcacagc
tacatcctcggcgttgtcatcgtgattccggcactctggctcatgcataggctgatgaaa
aagcatcaggataaaaatatctatgagctgctgagcgattcctcaccaatcgcaggccgg
attatcattttactgttttctttgtatttcctgttaatcaatgctcatgatatacgtttt
ttcatcaatttgattaacattttatttctcccgagaacaccaatggctgttcttggcggt
gttattatctttgtggcgatctgtattgccagagagggaaaagaaacattgaccagaatg
gcgcagatattcctatttccattcggcatcctggtcttgttccttccatttacgctggcc
acacaaattgagcttcaaaacttgacacctgtttttgaaggtctaatcccataccttcaa
tcaggctattacgcgtttgggacaatgggggaattgattatccttccgcttctcttctca
aaccggagcgtcccgctaaaatacaccattttcgcgatactgctgggcgctttattgctg
gccgtgatgttattttcttcaatttctgtctttggtcccaacctgacatctactttcttt
gatcctgcttatatggtcatcaggcagatccgcattacggattttctggatcgctcagac
ctgatcatcgcggctttttggattccggtcattatggtgaagatagcaggttccctatat
atcgtggtatacggcctttcgtttttacactcaaaaatcgacccgaaagccatgtataca
ccaaccggcatgttctcagtcgtatgcggcttttggttttttttaaatacaaatcagcta
atcgactttaacagaatcaaaccaatcattaatgtagtgatttctcttttgctgccttta
ctcatttatttgatcataaaaagcaaagcattgttcggcgcaaaagcaaaacactag

DBGET integrated database retrieval system