KEGG   Bacillus subtilis subsp. subtilis 168: BSU07820
Entry
BSU07820          CDS       T00010                                 
Symbol
treR
Name
(RefSeq) trehalose operon transcriptional repressor
  KO
K03486  GntR family transcriptional regulator, trehalose operon transcriptional repressor
Organism
bsu  Bacillus subtilis subsp. subtilis 168
Brite
KEGG Orthology (KO) [BR:bsu00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03000 Transcription factors [BR:bsu03000]
    BSU07820 (treR)
Transcription factors [BR:bsu03000]
 Prokaryotic type
  Helix-turn-helix
   GntR family
    BSU07820 (treR)
SSDB
Motif
Pfam: UTRA GntR Rrf2 HTH_Crp_2 HTH_DeoR HTH_36 HTH_11 PaaX HTH_41 NTP_transf_5 RepL
Other DBs
NCBI-GeneID: 936133
NCBI-ProteinID: NP_388663
Pasteur: BG11011
BSORF: BG11011
UniProt: P39796 A0A6M4JGI2
Structure
LinkDB
Position
853556..854272
AA seq 238 aa
MKVNKFITIYKDIAQQIEGGRWKAEEILPSEHELTAQYGTSRETVRKALHMLAQNGYIQK
IRGKGSVVLNREKMQFPVSGLVSFKELAQTLGKETKTTVHKFGLEPPSELIQKQLRANLD
DDIWEVIRSRKIDGEHVILDKDYFFRKHVPHLTKEICENSIYEYIEGELGLSISYAQKEI
VAEPCTDEDRELLDLRGYDHMVVVRNYVFLEDTSLFQYTESRHRLDKFRFVDFARRGK
NT seq 717 nt   +upstreamnt  +downstreamnt
atgaaggtgaataaattcatcacaatttataaagacatcgcacagcaaattgaaggcggc
cgatggaaagcggaggagattcttccgtctgaacatgagttgaccgcacagtacggtaca
tcaagagaaacggtccgaaaggcgcttcatatgctcgcgcaaaacggttatatccagaaa
atcaggggaaaaggctccgtcgtgctcaatcgtgaaaaaatgcagtttcccgtttcgggc
cttgtcagcttcaaggagctcgcgcaaacgcttggcaaagaaacgaaaacaactgtacac
aaattcgggctggagcctccgtcagagctgatccaaaaacagctccgggccaatctggat
gacgacatctgggaagtcatcaggtctagaaagattgacggggaacatgtgattttggac
aaggattactttttcagaaagcatgtccctcacctgacgaaagaaatttgtgaaaactcc
atatatgaatatatagaaggagagctcggtctttcgatcagttacgcccaaaaagaaatt
gtagccgagccgtgtacggacgaggacagagagctgctcgatttacgcggctatgaccat
atggtcgtggtgagaaactacgtctttttggaggataccagtttgtttcaatatacggaa
agcagacaccgtctcgacaaattccgatttgttgattttgcgcggcgggggaaatga

DBGET integrated database retrieval system