KEGG   Bacillus subtilis subsp. subtilis 168: BSU08200
Entry
BSU08200          CDS       T00010                                 

Symbol
malP
Name
(RefSeq) PTS system-maltose-specific transporter subunit IIBC
  KO
K02750  alpha-glucoside PTS system EIICB component [EC:2.7.1.208 2.7.1.-]
Organism
bsu  Bacillus subtilis subsp. subtilis 168
Pathway
bsu00500  Starch and sucrose metabolism
bsu02060  Phosphotransferase system (PTS)
Brite
KEGG Orthology (KO) [BR:bsu00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00500 Starch and sucrose metabolism
    BSU08200 (malP)
 09130 Environmental Information Processing
  09131 Membrane transport
   02060 Phosphotransferase system (PTS)
    BSU08200 (malP)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:bsu02000]
    BSU08200 (malP)
Enzymes [BR:bsu01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.208  protein-Npi-phosphohistidine---maltose phosphotransferase
     BSU08200 (malP)
    2.7.1.-  
     BSU08200 (malP)
Transporters [BR:bsu02000]
 Phosphotransferase system (PTS)
  Enzyme II [TC:4.A]
   Alpha-glucoside-specific II component
    BSU08200 (malP)
SSDB
Motif
Pfam: PTS_EIIC PTS_EIIB
Other DBs
NCBI-GeneID: 939713
NCBI-ProteinID: NP_388701
Pasteur: BG11848
BSORF: BG11848
UniProt: P54715 A0A6M3Z8L5
LinkDB
Position
892215..893798
AA seq 527 aa
MMQKIQRFGSAMFVPVLLFAFAGIIVGISTLFKNKTLMGPLADPDGFWYQCWYIIEQGGW
TVFNQMPLLFAIGIPVALAKKAQARACLEALTVYLTFNYFVSAILTVWGGAFGVDMNQEV
GGTSGLTMIAGIKTLDTNIIGAIFISSIVVFLHNRYFDKKLPDFLGIFQGSTYIVMISFF
IMIPIALAVSYIWPMVQSGIGSLQSFLVASGAVGVWIYTFLERILIPTGLHHFIYTPFIY
GPAVAEGGIVTYWAQHLGEYSQSAKPLKELFPQGGFALHGNSKIFGIPGIALAFYVTAKK
EKKKLVAGLLIPVTLTAIVAGITEPIEFTFLFISPFLFAVHAVLAATMSTVMYMAGVVGN
MGGGLIEAVTLNWIPLFGSHGMTYVYQILIGLSFTAIYFFVFRFLILKFNIATPGREKDE
QQETKLYSKKEYRERKNKDETASAAETADDTAFLYIEALGGKDNITEVTNCATRLRVSVK
DETKVEPDSVFRALGAHGVVRNGKAFQVIIGLSVPQMRERVEKILNQ
NT seq 1584 nt   +upstreamnt  +downstreamnt
atgatgcaaaaaattcagcgctttggaagcgcgatgtttgtgcctgttttattattcgcg
ttcgccggcattatcgtcggtatcagcacgctctttaaaaataaaaccctcatgggaccg
ctcgccgatcctgacggtttttggtatcagtgctggtatatcattgagcagggcggctgg
actgtttttaaccaaatgccgctcttattcgccattggcatcccggttgctttggcgaag
aaagctcaggcacgcgcctgtttggaagcgcttactgtctacctgacattcaactatttt
gtcagcgcgatattgacggtatggggaggagcatttggcgtcgacatgaatcaagaggtc
ggcggaacgagcgggttaacgatgattgcgggcataaaaacgctcgataccaacatcatc
ggagccatctttatttcttcgattgtcgtctttttgcataatcgctattttgataaaaaa
ctgcccgattttctcggcatctttcaaggctcaacatatatcgtgatgatttccttcttt
attatgatcccaattgcgttggctgtgtcttatatttggccgatggttcaatcgggaatc
ggctcgcttcaaagcttcctggttgcttctggggcggtgggcgtttggatatacacgttt
ttggaacggattttaattccgaccggccttcatcactttatttacacgccgtttatttat
ggcccggctgtagcggaaggcgggatcgtcacgtattgggcacagcatctcggcgaatat
tcgcaaagcgccaaaccgctgaaggagctctttccgcaaggcggattcgcgcttcacggc
aactcgaaaatcttcggtattccgggtatcgccctggctttttatgtgacagccaaaaag
gaaaagaaaaaactcgtcgcagggctgctgattcctgtcacactgacagcgattgtcgcc
ggtattacagagccgattgagtttacgttcttattcatttcacctttcttatttgcggtt
cacgccgtgcttgccgccacaatgtcgacagttatgtatatggccggcgtcgtcggaaat
atgggaggcggactgattgaggcggtaaccttgaactggattccgctctttggcagccac
ggtatgacatatgtgtatcaaattttgatcgggctctcgtttacagcaatttattttttc
gtcttcagatttttaatcctcaaattcaatatcgctacaccaggacgggaaaaggatgaa
cagcaggaaacaaagctatattcgaaaaaggaatacagagaacgaaaaaacaaggatgaa
acggcctccgctgctgaaacggctgatgacaccgcttttctgtatattgaagcgctgggc
ggaaaagacaacatcactgaagtcacaaactgcgccacccgcctcagagtcagtgtcaag
gatgaaacaaaggttgaacccgacagcgtattccgcgcgcttggcgcacacggcgttgtc
aggaacgggaaggcgtttcaggtaattatcggattaagcgtgccgcagatgcgggagcgt
gtggaaaaaatattgaatcaataa

DBGET integrated database retrieval system