KEGG   Bacillus subtilis subsp. subtilis 168: BSU08400Help
Entry
BSU08400          CDS       T00010                                 

Gene name
yfiU
Definition
(RefSeq) MFS transporter
Organism
bsu  Bacillus subtilis subsp. subtilis 168
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: MFS_1 Sugar_tr TRI12 MFS_4 MFS_2 OATP DUF4079 MFS_1_like
Motif
Other DBs
NCBI-GeneID: 936182
NCBI-ProteinID: NP_388721
Pasteur: BG12897
BSORF: BG12897
UniProt: O31563
LinkDB All DBs
Position
complement(914457..916013)
Genome map
AA seq 518 aa AA seqDB search
MSEALTEQKSQKWAISLFTIGVFMAALDNGIISAALTTINESFSVSPSWGSWGITLYTLG
LSVSVPIVGKLSDRYGRKKLFLIEVCLFGLGSLLVALSQSFPLFLISRLIQALGGGGIFI
IGSSHILATLPKEKQGKALGLLGAMNGMAAVLGPNIGSFLLDWTGSWHWLFLINLPIAVL
LVVFGACFIAETKAPEAKRLDAAGIFLLSLSILAVMYGMTNLDGANLLHSLGNPEVYGCI
IFGILCFAALISYEKRVEMRGGDPILAYSLLRNHMFQRTLIIGLLSGGLLAAVIFIPSYV
EQYLGVPAAKAGYWMTPLALASGIGAWLGGALTDKKGPVKTVILSGIISCAGFALFPLWV
TEKWEFVIASVAAGIGFGFLLGAPLNVLVSEAAKTNKGTALGTLSLVRQIGLTLAPTLYA
GFITAGFDQIGDEINSRLSDSGYSEKAMQMIPEIDSSEVSSLQEQIERIPVPEVKTAISD
AIHASVASGYDHLYAAAAVVSLLVIAAISIPAFRRQKR
NT seq 1557 nt NT seq  +upstreamnt  +downstreamnt
atgtctgaagcattaacagagcagaaaagccaaaagtgggcaatcagcctgtttacgatt
ggcgtgtttatggctgctttagataacggaattatttcggctgctttaacaacgataaac
gagtcgttttccgtttccccttcctggggatcatggggcattaccctttatacgctcggt
cttagcgtcagtgtgccaatcgtcggaaaactttccgaccgctacggcagaaaaaaactc
tttctcattgaggtttgcctgttcggacttggttctttgcttgttgctttgagccaaagc
ttcccgctctttctgatatcgcggctgattcaggcgcttggaggcggcgggattttcatc
atcggcagctctcacattctcgcgacccttccaaaggaaaaacaggggaaggcgcttggg
ctgcttggcgcaatgaacgggatggccgctgtgctcgggccaaatatcggaagctttctg
cttgattggaccgggtcttggcattggctatttttgattaatttgccgattgccgtgcta
ttggttgttttcggcgcatgttttatcgcggaaacaaaagcacctgaggctaagcgcctc
gatgcggccggaatcttccttttgtccctgtcgattttagctgtgatgtacggcatgacc
aatcttgacggggcaaatctcttacacagcttggggaatccggaggtttatggatgtatt
atttttggcatactctgttttgcagcgcttatctcgtatgaaaagagagttgaaatgcga
ggaggcgatcccattttggcgtattctctgctgcgaaaccatatgtttcagcgcacgctt
atcatcggtttgttatccggggggctcttggcggcagtcatttttatcccgtcatatgtc
gaacagtatttgggtgtccctgccgcaaaagcaggctattggatgacaccgcttgcgttg
gcttccggaatcggcgcttggcttggcggagcacttaccgacaaaaaaggtcctgtaaaa
accgttattctttcgggaatcatctcatgtgcggggtttgctttatttccgctctgggtc
acggaaaaatgggagtttgtgatcgcaagtgtggcagctgggatcggttttggctttctg
ttaggcgctccgctgaacgtccttgtatcagaagcggcaaaaacaaataagggtacagct
cttggcacgctttcattagtaaggcaaattggactgaccttggcgcctactctttatgca
ggttttatcacagccgggtttgaccaaataggtgatgagatcaacagccgcttatcggac
agcggatattcagaaaaggcgatgcagatgattccggagatcgacagttctgaagtttct
tctttacaagaacaaatcgaacgcattcccgttcctgaagtcaaaaccgcgataagcgac
gccattcatgcgagtgtcgccagcggctatgatcatttatatgcagcggctgctgtggtc
tcacttctggtgattgctgctatcagtattccggctttccgccggcaaaagcgttaa

DBGET integrated database retrieval system