KEGG   Bacillus subtilis subsp. subtilis 168: BSU08460
Entry
BSU08460          CDS       T00010                                 

Symbol
yfhA
Name
(RefSeq) siderophore transport system permease protein YfhA
  KO
K25111  iron-siderophore transport system permease protein
Organism
bsu  Bacillus subtilis subsp. subtilis 168
Brite
KEGG Orthology (KO) [BR:bsu00001]
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:bsu02000]
    BSU08460 (yfhA)
Transporters [BR:bsu02000]
 ABC transporters, prokaryotic type
  Metallic cation, iron-siderophore and vitamin B12 transporters
   Iron-siderophore transporter
    BSU08460 (yfhA)
SSDB
Motif
Pfam: FecCD ABC-3 RNF152_C DUF131
Other DBs
NCBI-GeneID: 939714
NCBI-ProteinID: NP_388727
Pasteur: BG12876
BSORF: BG12876
UniProt: O31569 A0A6M4JG64
LinkDB
Position
921472..922503
AA seq 343 aa
MKLRFGVTAAEKKAWIVFLVLLGLTAAVLIISAGLGQRFIPPWDVAKTFFGAGSKLDELM
IMSFRMPRILTALCAGVCLAAAGAILQGLVRNPLASPDIIGITGGAAVAVVLLMMFFSDR
SSSLTISLSWLPAAAFIGASAVGLIVYLLAYKNGASTFRLVLIGIGFSMSAQAMTTLLMI
KGPIYRASQANVYITGSVYGSNWQHVKIAIILSVILLFICFVALKNMNIQVLGEDIAAGA
GSAVQRNRFFLLLLSTALTGCAVSVAGTIGFVGLMAPHIARRLVGSSYGALLPASALIGA
LLVLTADIVGRTLFAPVEVPAGVFTAAIGAPYFIYLLYKTRNS
NT seq 1032 nt   +upstreamnt  +downstreamnt
atgaaacttcgttttggcgttactgcggctgaaaagaaagcatggatcgtctttttggtt
ttactggggttaacagctgctgtactcatcataagcgctggtctcggacaaaggtttatt
cctccctgggatgtagcaaaaacattctttggtgcaggttccaagctggatgaactgatg
atcatgtcgttccgcatgccaagaattttgacggctttatgcgccggtgtctgcttggca
gcggcaggcgcgatattgcaggggctcgtcagaaaccctctcgcatctccggatattatc
ggaataacaggaggagcggcggtagcggtcgtgcttttaatgatgttcttctcagaccgc
agcagttcacttacgatcagtctgtcatggcttccagcagccgcatttatcggcgcatcg
gctgtcgggctcatcgtctatttactggcatacaaaaatggcgcctccacatttcggctg
gtgcttatcggaatcggattttcaatgtcggcgcaggcgatgactaccctgttgatgatc
aaaggcccgatttaccgagcatcacaagccaatgtgtatatcactgggtcagtttatggg
tcaaactggcagcatgtaaaaatagctattatcttatctgtcattctcttattcatttgt
tttgtcgcgctaaaaaatatgaatatacaggtgctgggtgaagatattgcggcgggtgca
ggaagcgctgtgcagcgaaatcgttttttcttgctccttttgagtacggctcttactggt
tgtgcagtttcagttgccggcacaatcggttttgtcgggctgatggcgccccatattgca
agacggcttgtcggctcatcttatggcgcgctgctcccagcgtcggcacttattggagct
ctgctcgttttaacagctgatatcgtcggcagaaccttatttgctccggtggaagtgccg
gccggcgtctttacagcggctatcggcgcaccttattttatttatttgctctataaaaca
agaaattcttaa

DBGET integrated database retrieval system