KEGG   Bacillus subtilis subsp. subtilis 168: BSU08690
Entry
BSU08690          CDS       T00010                                 
Symbol
ygaD
Name
(RefSeq) ABC transporter ATP-binding protein
  KO
K24708  ATP-binding cassette, subfamily B, putative efflux pump [EC:7.6.2.-]
Organism
bsu  Bacillus subtilis subsp. subtilis 168
Brite
KEGG Orthology (KO) [BR:bsu00001]
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:bsu02000]
    BSU08690 (ygaD)
Transporters [BR:bsu02000]
 ABC transporters, eukaryotic type
  ABCB (MDR/TAP) subfamily
   ABCB-BAC subgroup
    BSU08690 (ygaD)
SSDB
Motif
Pfam: ABC_membrane ABC_tran SMC_N RsgA_GTPase AAA_29 AAA_16 ABC_ATPase ABC_membrane_3 NB-ARC Chordopox_L2 SPC12
Other DBs
NCBI-GeneID: 936200
NCBI-ProteinID: NP_388749
Pasteur: BG12224
BSORF: BG12224
UniProt: P71082 A0A6M3Z958
LinkDB
Position
939322..941091
AA seq 589 aa
MIKREGESTVGVMKRYMQFVKPYKKQIFVTVLIGIVKFSIPLALPLLLKYVVDDIIQGGG
TASDKTTSLFTIMAIMFALFLILRPPVEYYRQYFAQWTASKVLYDIRAKLFDHIQKLSLR
FYANTRTGEVISRVINDVEQTKDFVITGLMNIWLDMLTILIVISIMLTLDVKLTLISIVL
FPLYGISVKYFYGRLRKLTRERSQALAQVQGHLHERIQGMPVIRSFAIEDHEQAQFNEKN
GHFLDKAIRHTNWNAKTFAVVNTITDLAPLIVIACAGYFVINGPLTVGTMVAFVGYIDRM
YNPVRRLINSSTTLTQSIASMDRVFEFIDEPYELTDKPNAIKADQIRGGVEFQNVSFQYE
KDKENILHDVSLKVNRGETVALVGMSGGGKSTLVSLIPRFYDVTSGRLLIDGTDIRDYEA
RSLRNQVGMVLQDTFLFSETIRENIAIGKPDATLEEIIEAAKAANAHEFIMSFPEGYETR
VGERGVKLSGGQKQRISIARVFLKNPPLLILDEATSALDLESEHYIQEAMDKLAKDRTTF
VVAHRLSTITHADKIVVMENGTIIEIGTHDELMDYESQYKHLFTIQNLN
NT seq 1770 nt   +upstreamnt  +downstreamnt
atgataaagagagagggggaatcaaccgtgggggttatgaaacgctacatgcaattcgtc
aaaccttataagaagcaaattttcgttacagtgttaatcgggatcgtaaaattctccatt
ccgcttgctctcccattgcttctgaagtacgtagttgacgacattattcaaggaggcggc
acggccagtgacaaaaccacgtcattgttcacgattatggcgatcatgttcgccttattt
ttaattttgcgcccgcctgttgaatattaccggcaatattttgcccagtggactgccagc
aaggtgctttatgatataagagctaagctgtttgaccatatacaaaaactgagccttcgt
ttttacgcgaatacaagaacaggggaagtcatttcccgagtgattaatgatgtagaacaa
acaaaggatttcgtcatcacagggctgatgaatatatggctcgatatgctgacgattttg
attgtaatctctatcatgctcacactggacgttaaattaacgctgatctctatcgtttta
ttcccattatacggaatatcagtgaagtatttttacggccgtttacgaaagctgacaagg
gagcgctcacaggctcttgctcaagtgcaggggcatttgcatgaacgcattcaaggcatg
cctgtcatcagaagctttgcgatagaagatcatgaacaggctcaatttaatgagaaaaac
ggtcatttcttagataaagccatccgccacacgaattggaacgcgaaaacctttgcggtc
gttaataccattacagatttggcgccgctcatcgtcatagcgtgcgccgggtattttgtc
attaatggaccgctgacagtcggaacaatggtcgcgtttgtcggatatattgacagaatg
tacaaccctgttagaaggctgatcaattcctctacaactttgacacagtcaatcgcatca
atggacagggtgtttgaatttattgacgagccctatgaactcactgacaaaccaaatgcg
ataaaggccgatcagattcgcggaggagtggagtttcaaaacgtttcgtttcaatatgag
aaggacaaagaaaatattcttcatgatgtatccttaaaagtaaatagaggagaaactgta
gctctcgtcggcatgagcggaggaggaaaatcaacgctcgtcagcctgatcccaagattt
tatgatgtaacaagcggcagactgctgattgatgggacggatattcgcgattatgaagca
agaagccttcgcaaccaggttggtatggtgcttcaagatacctttttatttagtgaaacg
attcgggaaaatatcgcgatcggcaagcctgatgccacacttgaagagataatcgaagcc
gccaaagctgcaaatgcccatgaatttatcatgagttttccagaaggatatgagacccgg
gtgggggaacgaggcgttaagctttcaggcggacaaaagcagcggatctcaattgcgcgg
gtattcctgaaaaatccgccgctcctcattttagatgaagctacatcagctctggatttg
gaaagtgagcattacattcaagaagcgatggacaaactggcgaaggatagaacaactttt
gttgtcgcccaccgtttatcgacaatcacccatgcggataagattgttgtcatggaaaac
gggacaatcattgaaatcggaacccatgatgaactcatggactatgagagccaatacaag
cacttatttaccattcaaaatttgaactaa

DBGET integrated database retrieval system