KEGG   Bacillus subtilis subsp. subtilis 168: BSU08840
Entry
BSU08840          CDS       T00010                                 
Symbol
ssuA
Name
(RefSeq) aliphatic sulfonates-binding protein
  KO
K15553  sulfonate transport system substrate-binding protein
Organism
bsu  Bacillus subtilis subsp. subtilis 168
Pathway
bsu00920  Sulfur metabolism
bsu02010  ABC transporters
Brite
KEGG Orthology (KO) [BR:bsu00001]
 09100 Metabolism
  09102 Energy metabolism
   00920 Sulfur metabolism
    BSU08840 (ssuA)
 09130 Environmental Information Processing
  09131 Membrane transport
   02010 ABC transporters
    BSU08840 (ssuA)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:bsu02000]
    BSU08840 (ssuA)
Transporters [BR:bsu02000]
 ABC transporters, prokaryotic type
  Mineral and organic ion transporters
   Sulfonate transporter
    BSU08840 (ssuA)
SSDB
Motif
Pfam: NMT1 NMT1_2 OpuAC SBP_bac_3 NMT1_3 Phosphonate-bd
Other DBs
NCBI-GeneID: 936215
NCBI-ProteinID: NP_388764
Pasteur: BG10656
UniProt: P40400 A0A6M3Z8S0
LinkDB
Position
962179..963177
AA seq 332 aa
MKKGLIVLVAVIFLLAGCGANGASGDHKQLKEIRIGIQQSLSPLLIAKEKGWFEDAFEKE
GIKVKWVEFQSGPPQFEGLAADKLDFSQVGNSPVIAGQAAGIDFKEIGLSQDGLKANGIL
VNQNSGIQDVKGLKGKKIAVAKGSSGFDFLYKALDQVGLSANDVTIIQLQPDEAASAFEN
GSVDAWSIWEPYLSLETMKHGAKILVNGESTDLYSPGFTLVRTKFSEEHPDEVVRFLKVF
NKAVVWQKEHLDEAADLYSDIKDLDKKVVENVLKNTEPLNEIISDDIVKAQQETADFQFR
TKAIDKKIDVKDVVDNTFIKKALEEHSSGGDQ
NT seq 999 nt   +upstreamnt  +downstreamnt
atgaaaaaaggactcattgtattggttgccgttatttttctgctcgcaggctgtggagca
aatggagccagcggtgaccacaaacaattgaaggaaattcgtattggtattcagcaaagc
ttaagcccccttttgattgcaaaagaaaaaggctggttcgaagatgcatttgaaaaagaa
ggcatcaaagtgaaatgggtggagtttcaaagcggtccgccccaatttgaaggccttgcg
gcagacaaacttgatttttctcaagtcggtaattcgcctgtgatcgctggacaggcggca
ggcattgactttaaagaaatcggtttgtctcaggacggcttgaaagcaaacggcatcctt
gtcaatcaaaacagcggcattcaagacgttaagggcttaaaggggaagaaaattgcagtc
gccaaaggcagcagcgggtttgattttttgtataaagcgcttgatcaagtggggttgtca
gctaacgatgtgacaattattcagcttcagcctgatgaagcagcttccgcatttgaaaac
ggatctgttgatgcctggtccatttgggagccgtacttgtccttagaaacaatgaaacac
ggagcaaaaatccttgtgaacggagaaagcacagatttatattcaccgggttttacttta
gtaagaacaaagttttcagaagagcatccagacgaagtggtccgttttctgaaggtgttt
aataaagccgttgtatggcaaaaggaacatctggatgaagcagcggacttatattctgac
attaaagatctcgataaaaaggtcgtcgaaaatgtgctgaaaaatactgagccacttaat
gagatcatcagtgacgacattgtgaaagcacagcaggaaacagcagattttcaatttcga
acaaaggcgatagataagaagattgatgtgaaggatgttgtcgataacacttttatcaaa
aaagcattagaggagcattcctcaggaggtgatcaatga

DBGET integrated database retrieval system