KEGG   Bacillus subtilis subsp. subtilis 168: BSU09070Help
Entry
BSU09070          CDS       T00010                                 

Gene name
yhcG
Definition
(RefSeq) spermidine/putrescine ABC transporter ATP-binding protein
  KO
K01990  ABC-2 type transport system ATP-binding protein
Organism
bsu  Bacillus subtilis subsp. subtilis 168
Brite
KEGG Orthology (KO) [BR:bsu00001]
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:bsu02000]
    BSU09070 (yhcG)
Transporters [BR:bsu02000]
 ABC transporters, prokaryotic type
  ABC-2 type and other transporters
   ABC-2 type transporter
    BSU09070 (yhcG)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ABC_tran AAA_21 AAA AAA_23 AAA_15 AAA_29 SMC_N AAA_5 G-alpha AAA_22 AAA_27 AAA_33 KdpD AAA_30 AAA_14 Zeta_toxin AAA_2 Mg_chelatase AAA_24 AAA_16 SbcCD_C Rad17 VirE FlbD RsgA_GTPase
Motif
Other DBs
NCBI-GeneID: 939738
NCBI-ProteinID: NP_388788
Pasteur: BG11585
BSORF: BG11585
UniProt: P54591
LinkDB All DBs
Position
981604..982302
Genome map
AA seq 232 aa AA seqDB search
MEIKLEHVSKKYGRHTAVNDVSITLSSGRIYGLIGPNGSGKSTTLKMMAGLLFPTSGFVK
VDEEQVTREMVRQTAYLTELDMFYPHFTVKDMVNFYQSQFPDFHTEQVYKLLNEMQLNPE
KKIKKLSKGNRGRLKIVLALARRADVILLDEPFSGLDPMVRDSIVNSLVSYIDFEQQIVV
IATHEIDEIETLLDEVIILANGEKVAQREVEDIREQEGMSVLQWFKSKMEVC
NT seq 699 nt NT seq  +upstreamnt  +downstreamnt
atggaaatcaagctagaacatgtatcaaaaaaatacggccgccatacggccgtcaatgat
gtgtcaatcaccctatcatccggacggatttatggcctgattggaccgaacggcagcggc
aagtcaacgaccctgaaaatgatggctggccttctgtttccgacttcaggatttgtaaaa
gttgatgaagagcaggttacgagagaaatggtgcgtcaaacggcttatcttactgagctt
gatatgttttatccgcatttcactgttaaagatatggtgaatttttatcagtcgcagttt
cctgattttcatacagaacaggtttataagctattgaatgagatgcagctgaatccggaa
aaaaagatcaaaaagctatcaaaaggaaatcggggcaggctgaaaatcgttcttgcttta
gcgagacgggcagacgtcatcttgcttgatgaacctttttccgggcttgatccgatggtc
agggattccatcgtaaacagccttgtgtcgtacattgattttgagcagcagattgtcgtg
atcgcgacacatgaaattgatgaaattgagactttgttagatgaagtaatcatcctcgcc
aatggagaaaaagttgcgcagcgtgaagtagaagatattcgtgaacaggaaggcatgtct
gttttgcaatggtttaaatcaaaaatggaagtttgctag

DBGET integrated database retrieval system